DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and Rbm11

DIOPT Version :9

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_938044.1 Gene:Rbm11 / 224344 MGIID:2447622 Length:238 Species:Mus musculus


Alignment Length:225 Identity:63/225 - (28%)
Similarity:99/225 - (44%) Gaps:62/225 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDL 129
            ::|..||:|.|||:.||.||||||:||||||:..|.:..|.:|:|::||||.::...:|.:|:.|
Mouse     5 QEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTLCKDRDGKPKSFGFVCFKHPESVSYAIAL 69

  Fly   130 YQGLELFQKKVTIKQQGGKQL---PAYNQS----------RLRNQFM--------------MEAL 167
            ..|:.|:.:.:.::.:.|...   || |||          ..||..|              ..||
Mouse    70 LNGIRLYGRPINVQYRFGSSRSSEPA-NQSFESCAKINSHSFRNDEMAGRPSFPVPFFPITSAAL 133

  Fly   168 PQ------------------------PSPLRHA---RHSLHNGKPYDRNPFGHNADQRRRSDSSV 205
            ||                        |:||.::   ..:|::....:..|..:....:..||..:
Mouse   134 PQEYFFFQKMPWYAHSPVLQPPFCEMPAPLPNSVPGSCALNHSPGPEAGPSSYEWTHQPPSDPDL 198

  Fly   206 MERNRLKPQQHHQHMQGGSRRSDQRSNNKR 235
            ..||:.|.|:....       ||..|.:||
Mouse   199 YPRNKRKRQRPDSD-------SDSSSEDKR 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 33/73 (45%)
RRM <70..210 CDD:223796 54/193 (28%)
Rbm11NP_938044.1 RRM <5..139 CDD:223796 47/134 (35%)
RRM_RBM11 9..83 CDD:241037 33/73 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..238 13/57 (23%)
Bipartite nuclear localization signal. /evidence=ECO:0000305 202..237 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849231
Domainoid 1 1.000 73 1.000 Domainoid score I9202
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1298240at2759
OrthoFinder 1 1.000 - - FOG0003483
OrthoInspector 1 1.000 - - otm43349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5568
SonicParanoid 1 1.000 - - X2850
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.