DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and Tia1

DIOPT Version :10

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_035715.1 Gene:Tia1 / 21841 MGIID:107914 Length:386 Species:Mus musculus


Alignment Length:78 Identity:24/78 - (30%)
Similarity:39/78 - (50%) Gaps:1/78 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDL 129
            |||..:||:.|||...|||.::.::|.|.||.:..::..|..|.. .:.||.:........||..
Mouse     2 EDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGND-PYCFVEFHEHRHAAAALAA 65

  Fly   130 YQGLELFQKKVTI 142
            ..|.::..|:|.:
Mouse    66 MNGRKIMGKEVKV 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 21/74 (28%)
Tia1NP_035715.1 RRM1_TIA1 8..81 CDD:410027 21/72 (29%)
RRM2_TIA1 104..181 CDD:410030
RRM3_TIAR 214..286 CDD:241064
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..376
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.