DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and sf3b4

DIOPT Version :9

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_705947.3 Gene:sf3b4 / 192318 ZFINID:ZDB-GENE-020419-22 Length:400 Species:Danio rerio


Alignment Length:93 Identity:27/93 - (29%)
Similarity:53/93 - (56%) Gaps:6/93 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDN-NGRPRNFGFVTYQRLCAVPFALD 128
            |..:..|::.|.|||:|:|.:|:|:||||||:....:|.|. .|:.:.:|||.:.......:|:.
Zfish     8 ERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIK 72

  Fly   129 LYQGLELFQKKVTIKQQGGKQLPAYNQS 156
            :...::|:.|.:.:.:..     |:|::
Zfish    73 IMNMIKLYGKPIRVNKAS-----AHNKN 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 24/74 (32%)
RRM <70..210 CDD:223796 26/88 (30%)
sf3b4NP_705947.3 RRM1_SF3B4 15..88 CDD:240780 23/72 (32%)
RRM2_SF3B4 99..181 CDD:240781
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.