DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and rbm-7

DIOPT Version :9

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_499686.2 Gene:rbm-7 / 176710 WormBaseID:WBGene00012558 Length:243 Species:Caenorhabditis elegans


Alignment Length:173 Identity:46/173 - (26%)
Similarity:79/173 - (45%) Gaps:34/173 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 EQRTLFCGNLDERVTEEILYEVFLQAGPIEGV--RIPTDNNGRPRNFGFVTYQRLCAVPFALDLY 130
            |:||::..|..|.|.||:|.|:|:||||:..|  |...|:|.:   |..|.::...:|.||::|.
 Worm    11 EERTIYVANFSEEVDEELLEELFIQAGPVVKVILRDVRDSNAK---FALVEFEDELSVLFAIELM 72

  Fly   131 QGLELFQKKVTIKQQGG---KQLPAYNQSRLRNQFMMEALPQPSPLRHARHSLHNGKPYDRNPFG 192
            .|:.||.:::.:|.:.|   ::|....:..:..:....|.|.....|.:.....|     ||..|
 Worm    73 NGVRLFNQELQVKPRNGTNQEELYKRKKGEIEERVRSVAAPDRDGRRDSYRDDRN-----RNRNG 132

  Fly   193 HNADQRRRSDSSVMERNRLKPQQHHQH-----------MQGGS 224
            :|.|..::.          :|.:||:.           :.|||
 Worm   133 NNRDSWQQQ----------QPPRHHRQYDPLPPPPPPPLMGGS 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 27/75 (36%)
RRM <70..210 CDD:223796 39/144 (27%)
rbm-7NP_499686.2 RRM_SF 12..85 CDD:388407 27/75 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166376
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I4025
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1298240at2759
OrthoFinder 1 1.000 - - FOG0003483
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5568
SonicParanoid 1 1.000 - - X2850
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.