DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and eif-3.G

DIOPT Version :10

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001263666.1 Gene:eif-3.G / 174346 WormBaseID:WBGene00001230 Length:262 Species:Caenorhabditis elegans


Alignment Length:85 Identity:20/85 - (23%)
Similarity:38/85 - (44%) Gaps:22/85 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QLEDDDDEEEDEEQRTLFCG---------------------NLDERVTEEILYEVFLQAGPIEGV 99
            ||:::.|.::|.|:..:..|                     ||.:.:.|:.|.::|.:.|.:..:
 Worm   147 QLDEEADADKDTEKDRMAMGMRPDGRQIDRNRSDENTCRVTNLPQEMNEDELRDLFGKIGRVIRI 211

  Fly   100 RIPTDN-NGRPRNFGFVTYQ 118
            .|..|. .|.|:.|.|||::
 Worm   212 FIARDKVTGLPKGFAFVTFE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 15/72 (21%)
eif-3.GNP_001263666.1 eIF3G 33..143 CDD:240597
RRM_eIF3G_like 183..257 CDD:409842 14/49 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.