DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and EEED8.12

DIOPT Version :9

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_495021.1 Gene:EEED8.12 / 173922 WormBaseID:WBGene00017140 Length:197 Species:Caenorhabditis elegans


Alignment Length:88 Identity:24/88 - (27%)
Similarity:45/88 - (51%) Gaps:6/88 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 DDEEEDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDN-NGRPRNFGFVTYQRLCAVP 124
            ::|::..:.:::|.||:|...|.|.:.|.|...|.|....||.|. ..:.:||.::.:....::.
 Worm    52 EEEQKAIDAKSVFIGNVDFNSTIEEVEEHFKGCGHIVRTTIPKDKFTKKQKNFAYIEFDDSSSIE 116

  Fly   125 FALDLYQGLELFQKK---VTIKQ 144
            .|| :..| .||:.:   ||.|:
 Worm   117 NAL-VMNG-SLFRSRPIVVTAKR 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 22/77 (29%)
RRM <70..210 CDD:223796 23/79 (29%)
EEED8.12NP_495021.1 RRM <11..>133 CDD:223796 21/82 (26%)
RRM_II_PABPs 62..134 CDD:240752 20/73 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.