DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and EEED8.4

DIOPT Version :10

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_495022.2 Gene:EEED8.4 / 173921 WormBaseID:WBGene00017135 Length:191 Species:Caenorhabditis elegans


Alignment Length:38 Identity:12/38 - (31%)
Similarity:19/38 - (50%) Gaps:1/38 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EHGMMLADG-GDRFGVSTVCFDTQEELIWMGNQGGHVT 70
            |||...:|. ||...:|..||.:.|.::.:...|..:|
 Worm   121 EHGTNNSDTLGDPSNISLRCFGSIESILKVARDGIEIT 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 1/2 (50%)
EEED8.4NP_495022.2 RRM_II_PABPs 56..128 CDD:409747 3/6 (50%)

Return to query results.
Submit another query.