DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and rnp-8

DIOPT Version :9

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_490724.1 Gene:rnp-8 / 171627 WormBaseID:WBGene00020091 Length:583 Species:Caenorhabditis elegans


Alignment Length:192 Identity:49/192 - (25%)
Similarity:70/192 - (36%) Gaps:54/192 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 EEDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRN--FGFVTYQRLCAVPFA 126
            :.|...||.:...|...:::..|:|||.:...:|.|.:   .||..|:  ..|.|.|.|..|   
 Worm     4 QADRCDRTAYVSGLQPTISDIELFEVFNRVAHVEKVIV---RNGAARHALIVFKTVQGLYQV--- 62

  Fly   127 LDLYQGLEL------------------------FQKKVTIKQQGGKQLPAYNQS------RLRNQ 161
            |..:||..|                        |:|   :|.||.....:|.|.      |.:|.
 Worm    63 LVNFQGTTLHGRQLHIRPLRESSHANSEAISTMFEK---VKHQGNSGNSSYRQEHSFPEYRNQNP 124

  Fly   162 FMMEALPQPSPLRHARHS--LHNGKPYDRNPFGHNADQRRRSDSSVMERNRLK-PQQHHQHM 220
            .....|| |:|..| |:|  ..||        |.....||||.....:.|:.| |.:.:..|
 Worm   125 QASSYLP-PNPRGH-RNSTGCFNG--------GGGGYGRRRSAGGYNQYNQNKYPNETYPGM 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 23/99 (23%)
RRM <70..210 CDD:223796 44/173 (25%)
rnp-8NP_490724.1 RRM <1..140 CDD:223796 37/146 (25%)
RRM_SF 13..79 CDD:240668 19/71 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166377
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.