DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and RBM7

DIOPT Version :9

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001272974.1 Gene:RBM7 / 10179 HGNCID:9904 Length:267 Species:Homo sapiens


Alignment Length:151 Identity:47/151 - (31%)
Similarity:81/151 - (53%) Gaps:20/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDLYQ 131
            |..||||.|||:.:||||:|:|:|.||||:..|:||.|.:|:|:.|.||.::...:||:|::|..
Human     7 EADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLN 71

  Fly   132 GLELFQKKVTIKQQGGKQLPAYNQSRLRNQFMMEALPQPSPLRHARHSLHNGKPYDRNP---FGH 193
            |::|:.:.:.|:.:.|.                ...||...|.:.:|.:.|..|...:|   :..
Human    72 GIKLYGRPIKIQFRSGS----------------SHAPQDVSLSYPQHHVGNSSPTSTSPSSRYER 120

  Fly   194 NADQRRRSDSSVMERNRLKPQ 214
            ..| ...|.:.:::|:...|:
Human   121 TMD-NMTSSAQIIQRSFSSPE 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 33/73 (45%)
RRM <70..210 CDD:223796 45/142 (32%)
RBM7NP_001272974.1 RRM <9..>84 CDD:223796 34/74 (46%)
RRM_RBM7 9..83 CDD:241036 33/73 (45%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 25..35 5/9 (56%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 59..76 5/16 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..267
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158853
Domainoid 1 1.000 76 1.000 Domainoid score I8975
eggNOG 1 0.900 - - E1_KOG4454
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I5139
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1298240at2759
OrthoFinder 1 1.000 - - FOG0003483
OrthoInspector 1 1.000 - - otm41293
orthoMCL 1 0.900 - - OOG6_108583
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5568
SonicParanoid 1 1.000 - - X2850
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.690

Return to query results.
Submit another query.