DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and RBM7

DIOPT Version :10

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001272974.1 Gene:RBM7 / 10179 HGNCID:9904 Length:267 Species:Homo sapiens


Alignment Length:151 Identity:47/151 - (31%)
Similarity:81/151 - (53%) Gaps:20/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDLYQ 131
            |..||||.|||:.:||||:|:|:|.||||:..|:||.|.:|:|:.|.||.::...:||:|::|..
Human     7 EADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLN 71

  Fly   132 GLELFQKKVTIKQQGGKQLPAYNQSRLRNQFMMEALPQPSPLRHARHSLHNGKPYDRNP---FGH 193
            |::|:.:.:.|:.:.|.                ...||...|.:.:|.:.|..|...:|   :..
Human    72 GIKLYGRPIKIQFRSGS----------------SHAPQDVSLSYPQHHVGNSSPTSTSPSSRYER 120

  Fly   194 NADQRRRSDSSVMERNRLKPQ 214
            ..| ...|.:.:::|:...|:
Human   121 TMD-NMTSSAQIIQRSFSSPE 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 33/73 (45%)
RBM7NP_001272974.1 RRM_RBM7 9..83 CDD:410005 33/73 (45%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 25..35 5/9 (56%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 59..76 5/16 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..267
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.