DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and rbm11

DIOPT Version :9

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001373296.1 Gene:rbm11 / 100526814 ZFINID:ZDB-GENE-091204-317 Length:212 Species:Danio rerio


Alignment Length:78 Identity:31/78 - (39%)
Similarity:48/78 - (61%) Gaps:2/78 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 RTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDLYQGLE 134
            :|:..|||...||||||:|:||||||::.|.|..|....|  :..|.|:...|||:|::|..|:.
Zfish    10 KTIIVGNLHRCVTEEILFELFLQAGPVDKVHISRDGQQSP--YACVYYKHAEAVPYAVELLNGIW 72

  Fly   135 LFQKKVTIKQQGG 147
            |:.:.:.::...|
Zfish    73 LYGQPIKLQCNNG 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 30/72 (42%)
RRM <70..210 CDD:223796 31/78 (40%)
rbm11NP_001373296.1 RRM_SF 9..81 CDD:418427 30/72 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594805
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1298240at2759
OrthoFinder 1 1.000 - - FOG0003483
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108583
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5568
SonicParanoid 1 1.000 - - X2850
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.