DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and rbm11

DIOPT Version :9

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001096253.1 Gene:rbm11 / 100124814 XenbaseID:XB-GENE-975967 Length:243 Species:Xenopus tropicalis


Alignment Length:161 Identity:55/161 - (34%)
Similarity:77/161 - (47%) Gaps:27/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDL 129
            ::|..||||.||||..|.||||||:||||||:..|.|..|..|..:.||||.::...:||:|..|
 Frog     5 QEELDRTLFVGNLDCSVNEEILYELFLQAGPLTKVTIAKDKEGNSKAFGFVCFKHSESVPYAKAL 69

  Fly   130 YQGLELFQKKVTIKQQGGKQLPAYNQSRLR---NQFMMEALPQPSPLRHARHSLHNGKPYDRNPF 191
            ..|:.|:.:.:.:..|.|....|...:.|:   |.|:      |:|                ..:
 Frog    70 LNGIRLYGRPIKVHYQFGSSFSAEENNTLQSSDNGFI------PNP----------------QDY 112

  Fly   192 GHNADQRRRSDSSVMERNRLKPQQHHQHMQG 222
            |.||.:.|.:..|.|  |.:..||.....||
 Frog   113 GMNAPEDRSAAFSPM--NFVDFQQAFMFFQG 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 35/73 (48%)
RRM <70..210 CDD:223796 49/142 (35%)
rbm11NP_001096253.1 PABP-1234 <3..>174 CDD:130689 55/161 (34%)
RRM_RBM11 9..83 CDD:241037 35/73 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8827
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1298240at2759
OrthoFinder 1 1.000 - - FOG0003483
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5568
SonicParanoid 1 1.000 - - X2850
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.