DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and pkdc

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:344 Identity:72/344 - (20%)
Similarity:115/344 - (33%) Gaps:117/344 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KIKNL----PQVIEPHLPEGCTLDSYSTSYLTKP-------GDNYGSIMLSVQAKIRSADGGIRD 59
            ||:.|    .::|..|| |||...|....::..|       |.|..   :|.|.|:||       
Zfish    23 KIQTLWSGYGEIIRVHL-EGCDRPSVVVKHVMFPQNQKHPGGWNTD---ISHQRKVRS------- 76

  Fly    60 LPLIAKLPPLTNDLYW-QIFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSR 123
                     ...:.|| |.:.....|                                      |
Zfish    77 ---------YQVETYWYQNYTTNENC--------------------------------------R 94

  Fly   124 VSLDNRATKVDRDAVLVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVY 188
            |.|...|.....:.::|.|::...|:..  |....|.||....|.::|.:|||.:       .|.
Zfish    95 VPLCLAAKSFGEEQLIVLEDLDVAGFPV--RKTYVNDAEIKACLSWIANFHALFL-------DVT 150

  Fly   189 EEYVRPYFKKFDMNSNIDQAETEIMNKEILKDIKLVTSDERDVNRVKELLDIFQAFQASNDVD-- 251
            .|.:.|....:.:.:..:  |.|.|:.:.||                         .|:.::|  
Zfish   151 PEGLWPIGTYWHLETRPE--ELEAMSDQKLK-------------------------AAAGEIDSI 188

  Fly   252 --DGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVL 314
              :..|.|:||||..:.|...     .::|  |:|..||||....|..:.|:|:.|.|.:|....
Zfish   189 LNNCRFKTIVHGDAKLANFCF-----SKDG--LQVASVDFQYVGGGCGMKDVIYFLGSCMDEREC 246

  Fly   315 EDNFYNFLTIYYNAFIQTL 333
            |......|..|::...::|
Zfish   247 EKKAPGLLDYYFSELRKSL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 62/311 (20%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 48/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589359
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.