DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CHKov2

DIOPT Version :10

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster


Alignment Length:147 Identity:38/147 - (25%)
Similarity:55/147 - (37%) Gaps:37/147 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DTKQTLILLAVATTLAVSIKYLLPSFDLES----YRSIGSRVVAVVDN-------------VWQD 127
            :|...:.||.:||.:|..:.|      |||    :|.:.:|...|.||             :..|
  Fly   394 ETLDAVALLYMATQIASGMSY------LESRNFIHRDLAARNCLVGDNNLVKVADFGLARLMRDD 452

  Fly   128 FLTRCTRIRLPTFSWKM-ENLLQQAGTVSHTLYAVAFGLLLSSFTWYI-IYLDSSIPGVNPPTPF 190
            ..|.....:.| ..|.. |.|.....:....::  |||:||    |.| .|..|..||::....|
  Fly   453 TYTAHAGAKFP-IKWTAPEGLAYNKFSTKSDVW--AFGVLL----WEIATYGMSPYPGIDLTDVF 510

  Fly   191 SASKKRYR-----GGPP 202
            ...:..||     |.||
  Fly   511 HKLESGYRMERPPGCPP 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKL 35..337 CDD:397213 38/147 (26%)
CHKov2NP_651387.1 EcKL 40..326 CDD:397213
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.