DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CHKov1

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001097918.1 Gene:CHKov1 / 43067 FlyBaseID:FBgn0045761 Length:410 Species:Drosophila melanogaster


Alignment Length:397 Identity:101/397 - (25%)
Similarity:173/397 - (43%) Gaps:65/397 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GEVP---KIKNLPQVIEPHLPEGCTLDSYSTSYLTKPGDNYGSIMLSVQAKIRSADGGIRDLPLI 63
            |::|   ..:....|::.::.....:.::.....:..||||.:.||.|..::...||..::|..:
  Fly     4 GKIPDWVTAERFEDVLKSNVDGYSKVRNFKAEMGSAAGDNYATNMLRVNIEVELQDGTTKELSYM 68

  Fly    64 AKLP---PLTNDL--YWQIFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSR 123
            .|||   .:..::  :..||:.|||      :|..:.||::.|...:|:   ::..|...|    
  Fly    69 VKLPRQREINKEMMKHNNIFEIERT------MYNLVVPEMEALYKAAGV---EVTFGAKSY---- 120

  Fly   124 VSLDNRATKVDRDAVLVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVY 188
             .|.|..|:     .:..|::..:|::..||....:.|.|..:|..|||:||........|.|..
  Fly   121 -ELKNAQTE-----YISLEDLCIKGFKNANRLEGLDQAHTERVLRKLAQWHAATAVRVATKGQYP 179

  Fly   189 EEYVRPYFKKFD---MNSNIDQAETEIMNKEILKDIKLVTSDERDVNRVKELLDIF--QAFQASN 248
            |..:..:||:.:   ||..::.     |.:..:|.......:|..:.:||.|.|:.  :.|:.. 
  Fly   180 EIVLNGFFKEENRPMMNDMMNG-----MGQVFVKCCSTYEGNEAYIEKVKALKDVMIDELFKMC- 238

  Fly   249 DVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVD--- 310
            .||...|..|.|||.|.||:|.:|   .|.|...:|.:||||:::||::..|:.:.|.||..   
  Fly   239 VVDPTEFNVLNHGDSWSNNIMFQY---DESGKIKEVYMVDFQVSKYGTVAQDLYYFLISSTKLED 300

  Fly   311 --------VNVLEDNFYNFLTIY-YNAFIQTLRSVNVDTSNYTYELFLEEVQQTAHVQLPHAIFM 366
                    |.|..||....|.|. |:..:.:||.::  .|.|.|..|...|          |..:
  Fly   301 KLSKFDYYVKVYHDNLVEHLKILKYSKPLPSLRDIH--KSLYKYGTFAYSV----------ATGV 353

  Fly   367 MKVILAD 373
            |..:|.|
  Fly   354 MAAVLVD 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 89/323 (28%)
CHKov1NP_001097918.1 EcKinase 41..325 CDD:397213 86/311 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459628
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.