DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG10560

DIOPT Version :10

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster


Alignment Length:31 Identity:7/31 - (22%)
Similarity:12/31 - (38%) Gaps:7/31 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 TLILLAVATTLAVSIKYLLPSFDLESYRSIG 114
            |.:|.::.|.:..       .|..|..|.:|
  Fly     7 TCLLFSIVTVIGA-------EFSAEDCRELG 30

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKL 35..337 CDD:397213 7/31 (23%)
CG10560NP_651384.2 EcKL 52..333 CDD:397213
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.