DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG10553

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651383.1 Gene:CG10553 / 43064 FlyBaseID:FBgn0039324 Length:414 Species:Drosophila melanogaster


Alignment Length:343 Identity:82/343 - (23%)
Similarity:149/343 - (43%) Gaps:45/343 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPLTNDLYWQIFQPERTCITENAVYQYLSPELDK 100
            |:||.::||.::..:...|........:.|.|. .::.|.::.:.......|..:|..:.|||::
  Fly    52 GENYATVMLRIELDVEKEDNTQTTKAFMLKTPH-QSEQYRKVIEKTDIFDVERGMYVEVVPELEQ 115

  Fly   101 LQLESGI---LPAQIFDGFPRYYGSRVSLDNRATKVD-RDAVLVQENVTTRGYRPGNRHRPYNLA 161
            |..:.|:   ..|:::|                  :: .|..::.|::..||:...:|....:.|
  Fly   116 LYRDVGLEVKFGAELYD------------------IEASDYYVLLEDLRPRGFGNIDRLEGMDQA 162

  Fly   162 ETVLILHYLAQYHALPIALRLKKPQVYEEYVRPYFKKFDMNSNIDQAETEIMNKEILKDIKLVTS 226
            .|..:|...||:||.. |:|::....|:|   .|.|.|..|..|..|......|..|.::.|...
  Fly   163 HTECVLKKFAQWHAAS-AVRVETKGPYQE---KYTKGFLRNEEIVDAFINRSIKVFLDNVHLCKG 223

  Fly   227 DERDVNRVKELL-DIFQAFQASNDVDDGPFTTLVHGDLWINNMMLKYGMRGE-EGTPLKVKIVDF 289
            .|..:|.::.:. ..|:..::.|:.....|..|.|||.|.||:|.:|..:|| :.|    ..||.
  Fly   224 YETYLNDLRIVSGKTFEIVESLNNPSPDEFIALNHGDGWANNIMSQYNTKGEIQDT----YFVDL 284

  Fly   290 QIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIY------------YNAFIQTLRSVNVDTSN 342
            |:.::||:..|:.:.|.||..:::....|..|:..|            |:..:.|||.:|...:.
  Fly   285 QVPKWGSVTQDLYYFLLSSTSLDIKTSKFDYFIWFYHSELVKHLKLLGYSKTLPTLRRINDALNK 349

  Fly   343 YTYELFLEEVQQTAHVQL 360
            |:...|:......|:|.|
  Fly   350 YSGWSFICTATILAYVLL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 76/318 (24%)
CG10553NP_651383.1 EcKinase 52..333 CDD:281023 72/307 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459626
Domainoid 1 1.000 47 1.000 Domainoid score I8086
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.