DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG10553

DIOPT Version :10

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651383.1 Gene:CG10553 / 43064 FlyBaseID:FBgn0039324 Length:414 Species:Drosophila melanogaster


Alignment Length:43 Identity:9/43 - (20%)
Similarity:19/43 - (44%) Gaps:2/43 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 GTVSHTLYAVAFGLLLSSFTWYIIYLDSS--IPGVNPPTPFSA 192
            |.:.|.:..|..|.::......:.::::.  :..|.|..||.|
  Fly   145 GAIDHYVTPVKSGRVIVELAGELEFVEAKKILDIVCPKLPFKA 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKL 35..337 CDD:397213 9/43 (21%)
CG10553NP_651383.1 EcKL 52..333 CDD:397213 9/43 (21%)

Return to query results.
Submit another query.