DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG10559

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster


Alignment Length:413 Identity:99/413 - (23%)
Similarity:180/413 - (43%) Gaps:58/413 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GEVPKIKNLPQVIEPHLPEGCTLDSYSTSYL----------TKPGDNYGSIMLSVQAKIRSADGG 56
            |..|    :|..:..:|.|......|..:|.          .|||:||.:|||.::.::...|..
  Fly     6 GTAP----MPTWLRANLFEELLSKRYGGNYAGIKSFKPEAGLKPGENYSTIMLRLKLEVELQDHT 66

  Fly    57 IRDLPLIAKLPPLTNDLYWQIFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYG 121
            |.::..:.| .|...::|.:|.:.......|..|:..:.|||:::..:.|:              
  Fly    67 IENVSYMLK-TPYDFEMYREILRKNNMFAVERDVFIQVIPELEQMYKDVGV-------------- 116

  Fly   122 SRVSLDNRATKVDR--DAVLVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIA-LRLK 183
             .|....:|.::|.  |.||:|: :...|:|..:|....::..|..:|..:||:||:... :.||
  Fly   117 -EVKFGAKAYEIDAPDDYVLLQD-LGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLK 179

  Fly   184 KPQVYEEYVRPYFKKFDMNSNIDQAETEIMNKEILKDIKLVTSDER---DVNRVK-ELLDIFQAF 244
            .|.. :.|::|.:.. .|..:|:|. .|.:.|..||.:.|....|.   .|:::: :::|:..|.
  Fly   180 GPYP-QNYLQPTYAD-TMKESIEQV-AETLGKYFLKCLPLYEGYEEYSAAVHKMQPKIVDLMYAM 241

  Fly   245 QASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSV 309
               |..|...|..|.|||.|.:|:|.||  ..|...|::...||.|:.:..|:.:|:|:.|..|.
  Fly   242 ---NTPDPQDFNALNHGDCWTSNIMFKY--EDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGST 301

  Fly   310 DVNVLEDNFYNFLTIYYNAFIQTLRSVN-----VDTSNYTYELFLEEVQQTAHVQLPHAIFMMKV 369
            ...:....|..|:..|::..::.||.:|     ..|..:.:...|:..:...|:    |..:...
  Fly   302 KFEIQLSQFDYFIKYYHDHLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHI----AFILCPP 362

  Fly   370 ILADNSTIPKDYKDVDFSVLTKN 392
            :|.|.:   :|....||...|.|
  Fly   363 VLLDRT---EDANLTDFVTETDN 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 79/308 (26%)
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 79/309 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459627
Domainoid 1 1.000 47 1.000 Domainoid score I8086
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.