DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG31087

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001262952.1 Gene:CG31087 / 43062 FlyBaseID:FBgn0051087 Length:417 Species:Drosophila melanogaster


Alignment Length:389 Identity:77/389 - (19%)
Similarity:149/389 - (38%) Gaps:83/389 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPLTNDLYWQIFQPERTCITENAVYQYLSPELDK 100
            ||||.:..|.:..::...|...:||..:.|... :|::...|....:....|..:|..:.|:.:|
  Fly    52 GDNYSTQFLRLLVEVELIDHSTKDLSFVLKAQH-SNEMMAAILAKLKLFQKEEQMYHSILPKFEK 115

  Fly   101 LQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRDA---VLVQENVTTRGYRPGNRHRPYNLAE 162
            |..::               |..:....:|.|.|||.   .::.|::..:.::..||....:|..
  Fly   116 LYADA---------------GKPIQFAPKAFKFDRDLGVDYILLEDLHRKNFKNANRLAGLDLDH 165

  Fly   163 TVLILHYLAQYHALPIALRLKKPQVYEEYVRPYFKKFDMNSNIDQAETEIMNKEILKDIKLVTSD 227
            ...:|..||.:||....        |.|:...:.::|.:....:.      |:::|::.....:.
  Fly   166 MHKVLEKLAAFHAASAC--------YVEHHGLFGEEFTVGVFSES------NRQLLQEFNASGAF 216

  Fly   228 ERDVNRVKELLDIFQAFQASND--VD---------DGPFTTLVHGDLWINNMMLKYGMRGEEGTP 281
            ...:.:.|....|::....|:|  ||         ...|..|.|||.|.||:|.::   ...||.
  Fly   217 LAQLKKWKNAQKIYEKLADSDDYLVDRLLQDQQYNTREFNVLNHGDCWANNVMYQH---DAFGTI 278

  Fly   282 LKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYE 346
            .:...||||:.:|||..:|:.:::.||....:....|...:..|::..|:.|:            
  Fly   279 KETLFVDFQVGKYGSPANDLYYLILSSAAPELKTAKFDYLVRYYFDNLIENLK------------ 331

  Fly   347 LFLEEVQQTAHVQLPHAIFMMKVILADNSTIPKDYKDVDFSVLTKNTGAKTIVTKFEAILRLGK 410
                                   :|..:..:|| .|::..|:......|..:|:|...::.|.|
  Fly   332 -----------------------LLQYHRPLPK-LKNLHASLFRNGLAAYMVVSKVLPVVMLDK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 67/314 (21%)
CG31087NP_001262952.1 EcKinase 52..335 CDD:281023 68/350 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459630
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.