DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG10550

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:316 Identity:77/316 - (24%)
Similarity:142/316 - (44%) Gaps:38/316 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TKPGDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPLTNDLYWQIFQPERTCITENAVYQYLSPE 97
            |.||:||.|||:.|...|...||..:.:..|.| ..|..|....:.........|..:|:...|:
  Fly    51 TAPGENYTSIMIRVIVDILLKDGSEQRVSYILK-TMLEADSGADVIDGMGLFPKERKMYEVHIPQ 114

  Fly    98 LDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRD---AVLVQENVTTRGYRPGNRHRPYN 159
            ..||..|:|:               .:.|..:...||..   ..:|.|:::.:.::..:|.:.::
  Fly   115 FVKLYKEAGL---------------EIELAPKCLHVDATDELITMVFEDLSRQNFKNFDRLKGFD 164

  Fly   160 LAETVLILHYLAQYHALPIALRLKKPQVYEEYVRPYFKKFDMNSNIDQAET--EIMNK----EIL 218
            |.....:|..||:.||..:        |.:|...||...::|:...:|:..  |.:.|    :.|
  Fly   165 LPHMREVLRKLAELHAASV--------VAKEINGPYDAMYNMSIYNEQSRDLFESLGKQREEQFL 221

  Fly   219 KDIKL--VTSDERDVNRVKELLDIFQAFQASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTP 281
            |.::.  :.:.|..:.|:.:.|::|:.....|.||:..|..|.|||.|.||:|..|...||....
  Fly   222 KAMRNWDLENAESYIARMWDPLEVFEEAVQVNQVDEDEFNVLNHGDCWSNNIMFNYKDNGEIDRT 286

  Fly   282 LKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVN 337
            :   :||.|:.::||...|:.:::.:|..:::....|.:|:.||:....:.|:.:|
  Fly   287 I---LVDLQVGKWGSPAQDLWYLITTSASLDIKIKEFDHFIQIYHQRLAECLKLLN 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 75/312 (24%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 76/314 (24%)
APH 108..338 CDD:279908 59/255 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459623
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.