DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG31370

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:406 Identity:78/406 - (19%)
Similarity:148/406 - (36%) Gaps:103/406 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GDNYGSIMLSVQAKIR-SADGGIRDLPLIAKLPPLTNDLYWQIFQPERTCITENAVYQYLSPELD 99
            ||||.|::  ::|::. ....|.....||.|       ...::|.......||..:|:.:.||..
  Fly    48 GDNYASVI--IRARVEYITQKGFFSKSLIIK-------TVLEMFAGSALFKTEIGMYRKVLPEFA 103

  Fly   100 KLQLESGILPAQIFDGFPRYYGSRVSLDNRATKV-------DRDAVLVQENVTTRGYRPGNRHRP 157
            ::..|:        :...|.|...:......::|       :.|..:|::.|.|.|...|...: 
  Fly   104 RILREN--------NDTSRLYAECIYYSLEPSQVMIFEDLGEMDYAMVRDRVLTHGEICGAYSK- 159

  Fly   158 YNLAETVLILHYLAQYHALPIALRLKKPQVYEEYVR-------PY-------FKKF-DMNSNIDQ 207
                        ||::|||.:.:..::|:..:|:..       ||       ||.| .....:|:
  Fly   160 ------------LAKFHALSMKIINERPEFVKEFKDGICLVDIPYMSSGMGPFKDFLGRIPELDR 212

  Fly   208 AETEIMNKEILKDIKLVTSDERDVNRVKELLDIFQAFQASNDVDDGPFTTLVHGDLWINNMMLKY 272
            .:|..              ::.:|:.:..|.||.:.:|.:   ....:..|.|||....|:|:|:
  Fly   213 YKTHF--------------EKIEVHFIDRLRDIMKEYQTN---PQPGYYVLCHGDYHTRNIMVKH 260

  Fly   273 GMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVN 337
            ..  |.|......::|:|......|..|:::.::..::...........|..|::...:|||.:.
  Fly   261 NK--ESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLRETLRKIG 323

  Fly   338 VD---------------TSNYTYELFLEEVQQTAHVQLPHAIFMMKVILADNSTIPKDYKDVDFS 387
            ..               ..:|.: |||.       ..||.::.:......:..|   |.|..||.
  Fly   324 YQGKLPDPPAFWKEMYRLKDYEF-LFLS-------TYLPMSVGLSLETATNEET---DDKLQDFI 377

  Fly   388 VLTKNTGAKTIVTKFE 403
                 ...|:|:.:||
  Fly   378 -----EECKSILARFE 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 63/323 (20%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 63/324 (19%)
APH <202..320 CDD:279908 24/136 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459657
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.