DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG13659

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651378.1 Gene:CG13659 / 43059 FlyBaseID:FBgn0039319 Length:417 Species:Drosophila melanogaster


Alignment Length:431 Identity:80/431 - (18%)
Similarity:149/431 - (34%) Gaps:133/431 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPLTNDLYWQIFQPERTCITENAVYQYLSPELD- 99
            ||:|.|||...:.:..:.:|.... .||.|...:...:...:|:......||..:|..:.||.: 
  Fly    49 GDHYASIMFRARVEYTAQNGNFTK-SLIIKTMIVEEGIKKDMFKDSPLFTTEIGMYTKVLPEWER 112

  Fly   100 ---------KLQLE---SGILPAQ--IFDGFPRYYGSRVSLDNRATKVDRDAVLVQENVTTRGYR 150
                     ||.:|   ..:.|.|  |||          .|......|.||..|.:|.:::...:
  Fly   113 ILRRANDPAKLYVECIYHSLQPHQILIFD----------DLVEMGYAVVRDRFLTREEISSAYSK 167

  Fly   151 PGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVYEEY------------------------ 191
                               ||:.||:.:....::|:..:|:                        
  Fly   168 -------------------LAKIHAISMKFIHEQPEYLKEFKNGLCEMPGLIDSSIISGGMDPFM 213

  Fly   192 -----------VRPYFKKFDMNSNIDQAETEIMNKEILKDIKLVTSDERDVNRVKELLDIFQAFQ 245
                       .:|:|||..::               .||            |::|.:..::   
  Fly   214 EMLGRIPELSKYQPHFKKISLH---------------FKD------------RLRETMQEYR--- 248

  Fly   246 ASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVD 310
              |:...| :..|.|.|....|||.|...  |.|......::|:|......:..|:::.::..:.
  Fly   249 --NNPQPG-YNVLCHADFHSRNMMFKNNK--ETGCFEDCMLLDYQGCNVAPMAVDLMYSIYMLMG 308

  Fly   311 VNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYELFLEEVQQTAHVQ-------LPHAIFMM- 367
            .....:.....|..|.:..::||:.:....|..|.:.|..|:::..:.:       ||.:|.:. 
  Fly   309 PAQRREELDILLNYYLSILLETLKKIGYQGSMPTEQGFWAEMKRHRYYEFLLLSTFLPVSIGLRT 373

  Fly   368 -KVILAD----NSTIPKDYKDVDFSVLTKNTGAKTIVTKFE 403
             |:.:.|    ..|..|.|:..||...|     |:|:.:|:
  Fly   374 HKLDIGDMMHNEETRKKLYQLEDFMEET-----KSILDRFQ 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 62/350 (18%)
CG13659NP_651378.1 EcKinase 48..336 CDD:281023 62/351 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459656
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.