DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG11893

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster


Alignment Length:395 Identity:88/395 - (22%)
Similarity:157/395 - (39%) Gaps:66/395 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPLTNDLYWQIFQPERTCITENAVYQYLSPELDK 100
            ||:|.|:|....|:..::.|.... |||.|..|........:........||...|....||.::
  Fly    53 GDHYASVMFRTTAEYTTSKGKFCK-PLIIKTMPEQEGHKKDMLSDSHLFSTEINAYTKALPEFER 116

  Fly   101 LQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRDAVLVQENVTTRGYRPGNRHRPYNLAETVL 165
            :..|:|. ..::|  .|..|.   ||:.|       .||:.|::..:||.. .|.||.|:.|...
  Fly   117 ILREAGD-DTKLF--VPCIYH---SLEPR-------QVLIFEDLVPQGYFV-IRDRPINMNEYKN 167

  Fly   166 ILHYLAQYHALPIALRLKKPQVYEEYVRPYFKKFDMNSNI-DQAETEIMNK--EILKDIKLVTSD 227
            :...||::||:.:.:..::|.:.:::   .:...:|.|.: |...|..|:.  :::..|..:|..
  Fly   168 VFSKLAKWHAVSMKVLNEQPDILKDF---KYGLMEMPSIMSDPMVTTGMDNFLKMMDQIPELTKY 229

  Fly   228 ERDVNRVKE-----LLDIFQAFQASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIV 287
            :....::||     :.|:.|.:: .|...|| :..:.|||....|||..   :.||     |..|
  Fly   230 KPHFEKIKENYIQRMGDVMQEYR-KNVQSDG-YYVMCHGDFHGRNMMFN---KNEE-----VMFV 284

  Fly   288 DFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYT-------- 344
            ||||.....:..|:.:.::..::.....|...:.:..|::....||:.|.......|        
  Fly   285 DFQICNLCPITIDLSYSVYMLMEPEQRWDLGKDLINFYFSVLEDTLKKVGYKGKMPTNDGLWKQI 349

  Fly   345 -----YELFLEEVQQTAHVQLPHAIFMMKVILADNSTIPKDY------KDVDFSVLTKNTGAKTI 398
                 |:.||........|.:....|.:..::.|.....|.|      :||           |.:
  Fly   350 HRHKFYDFFLLTTFSPMIVAVKANTFKIHELIQDPEIRQKSYLYDPYVQDV-----------KKL 403

  Fly   399 VTKFE 403
            :.|:|
  Fly   404 LGKYE 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 73/308 (24%)
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 74/309 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459653
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.