DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG10514

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster


Alignment Length:379 Identity:90/379 - (23%)
Similarity:157/379 - (41%) Gaps:41/379 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EGCTLDSYSTSYLTKPGDNYGSIM--LSVQAKIRSADGGIRDLPLIAKLPPLTNDLYWQIFQPER 82
            ||.|:.....:....||:|||.::  ..|:..:.:.:..:::  ||.|.....::|..::..|..
  Fly    24 EGLTITQLQINPALGPGENYGGVLTRARVEFTLSNKEKNVQN--LIVKTEIDDDELTQELMAPYD 86

  Fly    83 TCITENAVYQYLSPELDKLQLESG----ILPAQIFDGFPRYYGSRVSLDNRATKVDRDAV-LVQE 142
            ....|..:||.:.|:..:|..|.|    |.|..|:                   |||:.: ::.|
  Fly    87 IYNREMTIYQEVLPKCRELLNEIGDTERIFPTAIY-------------------VDRERMAIIFE 132

  Fly   143 NVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVYEEYVRPYFKKF-DMNSNID 206
            :::..||...:|.|..|...|.|||..||::||....|..::....|.|.|.:|.:: :..|...
  Fly   133 DLSVVGYVMADRVRRLNEEHTHLILRKLAKFHAATAVLNERQSGCLESYDRGFFNRYTNAYSGYF 197

  Fly   207 QAETEIMNKEILKDIKLVTSDERDVNRVKELLDIFQAFQASNDVDDGPFTTLVHGDLWINNMMLK 271
            ........:.:.|...|....|:........:||.:...|..   .|....|.|||:|.||:|.|
  Fly   198 VGGLLAAARWMSKVPTLAHYGEKLFALAPHYMDIGRECFAPT---PGQVNVLAHGDVWTNNVMFK 259

  Fly   272 YGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSV 336
            |.  ...|.|:.|.::|||.:.:||...|:..:..:|:...:..|........|:..|.:||..:
  Fly   260 YD--PNTGRPVDVLLIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQNGLFQFYHKIFTETLEKL 322

  Fly   337 NVDTSNY-TYELFLEEVQQTAHVQLPHAIFMMKVILADNSTIPKDYKDVDFSVL 389
            |...:.. :...|..||:|.....|...:.:..|:::.:.|      |..|:.|
  Fly   323 NYRQNQIPSLHQFKLEVEQKRFFALHSTVVVQPVMISQDPT------DACFNAL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 76/309 (25%)
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 76/310 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459338
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.