DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG10513

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster


Alignment Length:390 Identity:96/390 - (24%)
Similarity:164/390 - (42%) Gaps:71/390 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TSYLTKP----GDNYGSIMLSVQAKIRSADGGIRDLPLIAKLP---------PLTNDLYWQ-IFQ 79
            |..:.||    ||||.|:|..|:         |..|...||.|         ...||.:.. ||.
  Fly    40 TDLVIKPATAKGDNYASVMTRVR---------ILFLKSGAKSPETEYYIVKTTYENDAFASGIFS 95

  Fly    80 PERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRDAVLVQENV 144
            ..:...||..:|:.:.|:|..| :|....|.::|       ...:.:|     .:.:|::.::..
  Fly    96 QYQVSTTEMRMYEKILPQLSSL-IEKTRQPEKVF-------AKTLHVD-----YEHEAIIFEDLA 147

  Fly   145 TTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVYEEYVRPYFKKFDMNSNIDQAE 209
            .|: |...:|...::|..|.|.|..||:.||....|..::|.:        ..|||  ..|....
  Fly   148 VTK-YVLADRLVGFDLEHTRLGLRKLAKMHAAAAVLNERQPGL--------LTKFD--HGIFNRH 201

  Fly   210 TEIMNKEILKDIKLVTSD---------ERDVNRVKELLDIFQAFQASNDVDD---GPFTTLVHGD 262
            |:......:..:. |.:|         ||...::|:|.:  :..:.|..|.|   |.|.||||||
  Fly   202 TQAFAPFFVNTVG-VAADFARECPELGERYATKLKKLQE--RVMEYSTRVYDPQPGDFNTLVHGD 263

  Fly   263 LWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYN 327
            .|:||:||:|   ||...||.:.::|||...:.|...|:.:...:||.|::..:........|:.
  Fly   264 YWVNNVMLRY---GENKEPLDMTLIDFQFCSWSSPAVDLHYFFNTSVQVDIRYEQQDALFQYYHT 325

  Fly   328 AFIQTLRSVNVDTSNYTYELFLEEVQQTAHVQLPHAIFMMKVILADNSTIPKDYKDVDFSVLTKN 392
            ..::||:.:|......|...|:.::::.....:..|:....::..|.:.      |.||:.|.|:
  Fly   326 VLVETLKDLNFGGYIPTLRQFVLQLERGRFFAVTVALVCQAILTNDQNA------DADFNALMKD 384

  Fly   393  392
              Fly   385  384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 84/327 (26%)
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 83/324 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459340
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.