DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG10513

DIOPT Version :10

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster


Alignment Length:98 Identity:24/98 - (24%)
Similarity:35/98 - (35%) Gaps:23/98 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RRLSFN-GSDMELSDLKGVQGAASDREKNAIDTKQTLILLAV-------------ATTLAVSIKY 100
            |.|.|| |..:....|:....||...:.|.:..|..:.|.:|             |..|.:|: |
  Fly   311 RTLDFNLGKPLPTHFLRRFSKAAKASDVNHVLAKYLIELASVDYSTAHYKPSEIAAAALYISL-Y 374

  Fly   101 LLPSFDLESYRSIGSRVVAVVDNVWQDFLTRCT 133
            |.|   |.|....|:..:     :|...|...|
  Fly   375 LFP---LTSNGGNGTSAI-----IWTKTLEHYT 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKL 35..337 CDD:397213 24/98 (24%)
CG10513NP_651370.2 EcKL 50..336 CDD:397213 8/24 (33%)

Return to query results.
Submit another query.