DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG14314

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:413 Identity:91/413 - (22%)
Similarity:175/413 - (42%) Gaps:57/413 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QVIEPHLPEGCTLDSYSTSYLTKPGDNYGSIM--LSVQAKIRSADGGIRDLPLIAKLPPLTNDLY 74
            |.|..|:.....:|::..:..:..||||.:.:  :.:..|.||...   :..:|.|:.| .:.:.
  Fly    32 QDIFKHVEPDVQIDAFELAQGSDRGDNYTAALYRIKLTGKRRSLKW---EQNVICKVMP-ESVVA 92

  Fly    75 WQIFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRDAVL 139
            .:.::.::....|...|..:.|||.|.|.........:|:..|:.|.:|..|            |
  Fly    93 REAYKSDKLFRNEVQFYNTIMPELLKFQASKTNQDTPVFNAIPKCYSARHDL------------L 145

  Fly   140 VQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVYE--------------- 189
            :.|::..||::..:||:..:|.||..:|..:||.|.|.:|.:.:||..:.               
  Fly   146 IMEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKPLEFSNLCSMISEGIFCTAN 210

  Fly   190 -EYVRPYFKKFDMNSNIDQAETEIMNKEILKDIKLVTSDERDVNRVKELLDIF--QAFQASNDVD 251
             .:.|.|:::...|:      .:::::.:..|.|.|.:    :|:..|....|  ....||.   
  Fly   211 TSWYRNYYERLTKNA------IQMVSEVLPPDSKYVLA----MNKFAESSSFFGRMVKLAST--- 262

  Fly   252 DGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLED 316
            :.|.:.:.|||.|:||.:..|... :....|:|.::|||:.:|.|:..||..:|:......:.:.
  Fly   263 ESPLSAICHGDCWVNNFLYHYDPE-DPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTKEMRDA 326

  Fly   317 NFYNFLTIYYNAFIQTLRSV------NVDTSNYTYELFLEEVQQTAHVQLPHAIFMMKVILADNS 375
            .....|.||.....:.|:.:      :.||.....:||.||::......|..|:.::.:....:.
  Fly   327 QLQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKLQDLFAEELKTYGRFALGLALDILPISTCSSE 391

  Fly   376 TIPKDYKDVDFSVLTKNTGAKTI 398
            ..|..|.|.. ..|.::.||.|:
  Fly   392 DAPDMYLDRS-DELGEDVGAPTL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 72/327 (22%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 72/319 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.