DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG6834

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster


Alignment Length:408 Identity:97/408 - (23%)
Similarity:172/408 - (42%) Gaps:67/408 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EVPK--------IKNLPQVIEPHLPEGCTLDSYSTSYLTKPGDNYGSIMLSVQAKIRSADGGIRD 59
            |.||        :.:..:||....||...:...|.|..||||||:.|.:|.:..:.:..|...:.
  Fly   489 ENPKNQILDWLNVSDFAEVISSAEPEFDKIVGGSWSSATKPGDNFASKLLKIDIETQLKDHTSKT 553

  Fly    60 LPLIAKL-PPLTNDLYWQI-FQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGS 122
            ...|.|: |..|.|.:..: ..|:     |..:||...|..::|..::|:......:.|      
  Fly   554 FSYILKVQPKSTPDNFTDVNMFPK-----EMEMYQKYVPAFEQLYKDAGLTVTFTANSF------ 607

  Fly   123 RVSLDNRATKVDRDAVLVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALR------ 181
               :.|:|.|   :..|:.||:.|:|::..:|.:..|:..|...|..|||:||..|..:      
  Fly   608 ---VLNKAVK---EEYLLMENLQTKGFKMADRMKGLNMEHTKSSLKKLAQWHAASIKYKELNGAY 666

  Fly   182 --LKKPQVYEEYVRPYFKKFDMNSNIDQAETEIMN-----KEILKDIKLVTSDERDVNRVKELLD 239
              |....:|.|..|..|  .:|.::..:|...|..     .|.|..::.:..     |.|.::|:
  Fly   667 PPLYNDGIYIEQTRDVF--HNMFASAKEAYIRIFGTFEGADEYLPKLEWIID-----NHVDQVLE 724

  Fly   240 IFQAFQASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFV 304
                   ...:::..|..|.|||.||||:|.:|   ..||...:..::|.|.|:||:...|:.:.
  Fly   725 -------DAKINEQAFNVLNHGDAWINNIMFQY---DAEGRLKETYLLDHQNAKYGNPAQDLYYF 779

  Fly   305 LFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYELFLEEVQQTAHVQLPHAIFMMKV 369
            |.||.::::..|.|.|.:..|:...::       .|....|..|:..:.:...:.:.|..|.:..
  Fly   780 LISSAELDIKVDEFDNLIRFYHENLVE-------HTKLLKYNGFVPSLSELHAILIEHPAFAVGT 837

  Fly   370 ILADNSTIPKDYKDVDFS 387
            ::   ||:.....|..|:
  Fly   838 VI---STLTVCLTDEGFN 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 77/316 (24%)
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 78/324 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459632
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.