DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG6830

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:397 Identity:85/397 - (21%)
Similarity:169/397 - (42%) Gaps:77/397 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PQVIEP----HLPEGCTLDSY----------------STSYL-TKPGDNYGSIMLSVQAKIRSAD 54
            ||..:|    .:|:...:|.:                |||.| ||||||:.|.:|.|:.:.:..|
  Fly   471 PQQPQPENTDQIPDWLNIDDFKEIILSAEPNFEKILSSTSKLATKPGDNFASKLLKVEIEAQLKD 535

  Fly    55 GGIRDLPLIAKLPPLTNDLYWQIFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRY 119
            ..::....|.|:....:.:.:..|.              |.|:  ::::.|..:||     |.|:
  Fly   536 NSVKTFSYILKVHSDNDAINFSDFN--------------LFPK--EIEVYSTYVPA-----FERF 579

  Fly   120 Y---GSRVSLDNRATKVDRDA---VLVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPI 178
            |   |..|:...::.::.:|.   .|:.||:...|::..:|....:|..:...|..|||:||..:
  Fly   580 YKDVGLPVTFSPKSFRLSKDVSKEYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASL 644

  Fly   179 ALR-LKKPQ-------VYEEYVRPYFKKFDMNSNIDQAETEIMNKEILKDIKLVTSDERDVNRVK 235
            ..: |..|.       ::.|...|.||...:|:          .|..::::......:..::::.
  Fly   645 KYKELNGPYSPKYNNGIFTEQTAPIFKGMFVNT----------KKSFIEEVSKFDGVDEYLHKMP 699

  Fly   236 ELLDIF-QAFQASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVH 299
            |:||.: ........:::..|..|.|||.||||:|.:|   ..:|...:..::|.|:.:||:...
  Fly   700 EILDTYVDRILEDAKINEQAFNVLNHGDAWINNIMFQY---ESDGRVKETLLLDHQVTKYGNPAQ 761

  Fly   300 DIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYELFLEEVQQTAHVQLPHAI 364
            |:.:.:.||..:::..|.|...:..|:....:..:.:|       |..|:..:::...:.:.|.|
  Fly   762 DLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAKLLN-------YNGFIPSLKELHAILIQHPI 819

  Fly   365 FMMKVIL 371
            |....:|
  Fly   820 FAAGTVL 826

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 67/316 (21%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 68/324 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459633
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.