DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG13813

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster


Alignment Length:326 Identity:78/326 - (23%)
Similarity:144/326 - (44%) Gaps:45/326 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 YYGSRVSLDN------RATKVDR-----------------DAVLVQENVTTRGYRPGNR--HRPY 158
            ||...|.:..      ||...||                 |..|:.|:::..|:||.:|  ...|
  Fly    75 YYAREVFMYQKVFPVFRALSPDRNTFTVAPALQANDLKAPDEFLIFEDLSESGFRPNSRCIMPTY 139

  Fly   159 NLAETVLILHYLAQYHALPIALRLKKPQVYEEYVRPYFKKFDMNSNIDQAETEIMNKEILK-DIK 222
            ::  .|..|..||:.||....|:...|..:::.|....|.....|:|::...|....::.| .|.
  Fly   140 DI--VVCSLKALAELHACSFILQQTDPLQFKQLVEFVEKDNLFTSDIEEVTIEFGKAQLRKARII 202

  Fly   223 LVTSDERDVNRVKELLDIFQ------AFQASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTP 281
            |..||...|..|:|:|.:.:      |....:.....|...:.|||.|.||::.::....::  |
  Fly   203 LKESDGDQVAAVQEVLQLCENQLKSLALYCVDGKAQAPHAVICHGDFWNNNILYRHEPNSDQ--P 265

  Fly   282 LKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSN-YTY 345
            ::.|::|||:::|...|.||:..||:..:..:.:::|.:|:..|||...|.|:|.|:.... |..
  Fly   266 VEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGIYPR 330

  Fly   346 ELFLEEVQQTAHVQLPHAIFMMKVILAD-NSTIPKDYKDVDFSVLTKNTGA-----KTIVTKFEA 404
            .:|..::||.....|....|.:...::: |..|  |...|..::.:.:|.:     |.::.::|.
  Fly   331 SVFNRQLQQYGVYGLIMGAFSLPFFISNANEVI--DIDTVSEAIQSISTSSDEPKYKELIEEYEM 393

  Fly   405 I 405
            :
  Fly   394 L 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 64/249 (26%)
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 64/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459660
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.