DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG5644

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster


Alignment Length:397 Identity:78/397 - (19%)
Similarity:163/397 - (41%) Gaps:76/397 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LDSYSTSYL-----TKPGDNYGSIMLSVQAKIRSAD-----GGIRDLPLIAK--LPPLTNDLYWQ 76
            |.|:|.:::     :..||||.|::..|.......|     .|...:.:|.|  :..|:..   |
  Fly    48 LVSFSIAHIACSAGSSSGDNYMSVVKRVTISQAGKDQDPELAGSEIVTVIVKRQIASLSRR---Q 109

  Fly    77 IFQPERTCITENAVYQYLSPEL---DKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRDAV 138
            :::.|.....|...|::|:|.|   .:.||            ||..:.:. |.|.|..: ..:.:
  Fly   110 LYRCEEAFSNEINAYRHLAPLLAAHSRHQL------------FPVCHIAE-SQDRRDAE-GGEPI 160

  Fly   139 LVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQ------------VYEEY 191
            :|.:::...|:|..:|.....|::.:|::..|||.||..:|.:..:..            ||.:.
  Fly   161 IVLQDLKAMGFRMKDRLAGLELSDCLLVMKKLAQLHAASLAAQELESSSFAFHADHLQEIVYCDE 225

  Fly   192 VRPYFKKFDMNSNIDQAETEIMNKEILKDIKLVTSDE---RDVNRVKEL-LDIFQAFQAS-NDVD 251
            ...::... :::::.||         |:.:....:|:   ..:..::|| .::|:..:.. |...
  Fly   226 ATDFYATI-LDTSVQQA---------LESLGDANADDCLTTPIRLLEELRTNLFENLKHEINATA 280

  Fly   252 DGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLED 316
            ..|.:.:.|||||:||:|.:       ..|.:|...|.|..:..|.:.||:..:::|....:.:.
  Fly   281 AAPNSVICHGDLWVNNIMFR-------SEPEEVIFFDLQAMRKSSPIFDILHFIYTSTRRPLRDV 338

  Fly   317 NFYNFLTIYYNAFIQTLRSVNVDTS----------NYTYELFLEEVQQTAHVQLPHAIFMMKVIL 371
            :....|..|..|..:.||....||:          .::.:....:..:..|..|...::::..:.
  Fly   339 HTDTLLAAYSQALSEELRHQLEDTTAAERLEELCEAFSLQRLSSDYVRQVHYGLAIGMWILPAVT 403

  Fly   372 ADNSTIP 378
            .|.:.:|
  Fly   404 FDPNNLP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 69/328 (21%)
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 68/325 (21%)
P-loop_NTPase <357..435 CDD:304359 6/54 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.