DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG11891

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001027211.3 Gene:CG11891 / 3772439 FlyBaseID:FBgn0039309 Length:417 Species:Drosophila melanogaster


Alignment Length:360 Identity:75/360 - (20%)
Similarity:137/360 - (38%) Gaps:108/360 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GDNYGSIMLSVQAK--------------IRSADGGIRDLPLIAKLPPLTNDLYWQIFQPERTCIT 86
            |:||.|::..:..:              .|.||.|                       |....:.
  Fly    48 GENYSSVITRIYVEYTTDKSKDKQSTRFTRFADAG-----------------------PAAQVLL 89

  Fly    87 ENAVYQYLSPELDKLQLESGILPA-------QIFDGFPRYYGSRVSLDNRATKVDRDAVLVQENV 144
            ...||   :.|||   |...|||.       ::.|....:.|: |.:|.:     ||:::. |::
  Fly    90 SYGVY---NRELD---LYERILPQMAEVVRNELADSRKLFAGT-VYVDRK-----RDSIIF-EDM 141

  Fly   145 TTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVY-EEYVRPYFKKFDMNSNIDQA 208
            :...||..:|.:..:|..|.|:|..||.:||...||..::|.:: :.:.|.:|.:....      
  Fly   142 SLENYRVADRLKKLDLEHTHLVLEKLANFHAAGAALAERQPGIFAKNFDRGFFNQHTRG------ 200

  Fly   209 ETEIMNKEILKDIKLVTSDERDVNRVKELLDIFQAFQA---------------SNDVDDGPFTTL 258
                 .:.|:|::.:..|...::..     |:.|.:||               |..:..|.|.||
  Fly   201 -----YEPIMKNLLMALSRSLELEP-----DLCQRYQAKIDRLVENVMEYGERSTTIVPGDFLTL 255

  Fly   259 VHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLT 323
            .|||||..|:|.:|   .::|.|:....:|||.:.:.|...|:.:...:::..::........:.
  Fly   256 AHGDLWTTNIMFQY---DDKGHPINAIFIDFQFSAWNSPAIDLHYFFSTALQADIRLKKQPELVQ 317

  Fly   324 IYYNAFIQTLRSVNVDTSNYTYELFLEEVQQTAHV 358
            .||                |.....|::||.:.:|
  Fly   318 FYY----------------YKLNAALKKVQYSGNV 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 70/337 (21%)
CG11891NP_001027211.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.