DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG16898

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster


Alignment Length:420 Identity:89/420 - (21%)
Similarity:173/420 - (41%) Gaps:102/420 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TKPGDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPLTND-------LYWQIFQPERTCITENAV 90
            |:.|.||.|:|..:..:|:..||.:::...|.| ..|:.|       |.:.::..|..      :
  Fly    35 TEKGQNYMSLMTRIHVEIQQGDGLLQNRTYIIK-ESLSEDCPQAKVFLEYDVYNREMD------M 92

  Fly    91 YQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRD-AVLVQENVTTRGYRPGNR 154
            |:::.|::::|..|.|:.             .:.:.|  ...|||: ..::.|::....|...:|
  Fly    93 YEFILPKMNELLQEVGLT-------------GKFTAD--TIFVDREYRTIILEDLAQYNYVNADR 142

  Fly   155 HRPYNLAETVLILHYLAQYHALPIALRLKKPQVYEEYVRPYFKKFDMNSNIDQAETEIMNKEILK 219
            .:..:||.|.|.|..||::||..|.::.:.|::..:.:  :...|   |..::..||:....:..
  Fly   143 VKQLDLAHTKLTLEVLAKFHAASIVVKQRHPELLTKSL--FIHCF---SRDNKGYTEVYEGVLSA 202

  Fly   220 DIKLVTSDERDV------NRVKELLDIFQAFQASN-DVDDGPFTTLVHGDLWINNMMLKYGMRGE 277
            .|:.:  :|:.|      |:::::.:....:.|.. :|.:....||.|||.|..|.:.:|   .:
  Fly   203 FIRFI--NEQPVLKKKYGNKLQKIHENIMDYGARTFEVGEQELLTLSHGDCWTTNFLYQY---DD 262

  Fly   278 EGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSV------ 336
            ...|.....:|||.:.:.|.|:|:                 :.|.|:.....:|.:.||      
  Fly   263 ASNPQSAVAIDFQFSNFTSPVNDL-----------------HQFFTVSLRDEVQDMESVLVEKYY 310

  Fly   337 -----NVDTSNY-----TYELFLEEVQQ------TAHVQLPHAIFMMKVILADNSTIPKD----Y 381
                 ||||.:|     :.:.|.::.:.      .||:..|       ||:.|.:.:..|    |
  Fly   311 SDLKTNVDTLSYKGIFPSLQGFQKQFESRRFMCLLAHLFKP-------VIIYDGTEVSSDFSSVY 368

  Fly   382 KDVDFSV-----LTKNTGAKTIVTKFEAIL 406
            ||.:..:     :..|.......||..|:|
  Fly   369 KDTEEGIRFQKAIYANERVLKSATKLLAML 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 67/327 (20%)
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 71/333 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459332
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.