DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and JhI-26

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster


Alignment Length:446 Identity:90/446 - (20%)
Similarity:161/446 - (36%) Gaps:113/446 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LPQVIEPHLPEGCTLDSYSTSYLTKPGDNYGSIMLSV--------------------------QA 48
            ||.:    |..|..:|:||.|.:|.  .:.|.|.:.|                          |.
  Fly    16 LPSI----LRNGRLVDNYSESKVTT--FHVGDIDIDVIGHSEAFMLTFCYRTTINFEYDGQKFQR 74

  Fly    49 KIRSADGGIRDLPLIAKLPPLTNDLYWQI-FQPERTCITENAVYQYLSPELDKLQLESGILPAQI 112
            |:           ::.|.|.:..::|..| |.|..|  .|...|..:.||..|..          
  Fly    75 KM-----------VVKKTPAMPPEMYESIQFGPLFT--NEINFYTEILPEFQKFT---------- 116

  Fly   113 FDG---FPRYYGSRVSLDNRATKVDRDAVLVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYH 174
             ||   .|:||...::        ...||.:.||...:|:|........:|...::.:.||.::|
  Fly   117 -DGKFAAPKYYYGELN--------QHSAVAILENFAEQGWRVTKDRVGLSLQHAMIAVSYLGRFH 172

  Fly   175 ALPIALRLKKPQVY-------------EEYVRPYFKKFDMNSNIDQAETEI------MNKEILKD 220
            ....|::.|.|:.:             .:.:.|.: |..|.::||:|...:      :::|.:|.
  Fly   173 GFAYAMKHKNPEKFAQLTDNLKESRYANDNIHPEW-KLTMKTSIDRAAKAVATYQPQIDEEFVKK 236

  Fly   221 IKLVTSDERDVNRVKELLDIFQAFQASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVK 285
            ...:.||.....|.:         .|..:    |..||.|||...||:..:|..:.|   |.::.
  Fly   237 FCFMISDYSQYGRQR---------VAPRE----PLATLCHGDYVRNNVAYRYDDKEE---PQEIM 285

  Fly   286 IVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIY----YNAFIQTLRSVNVDTSNYTYE 346
            :.|:|..:..|.:.|:...|..|:...|.:.||......|    :|::.:..:....|..: ..|
  Fly   286 MFDYQTLRVSSPMVDLNVFLAVSIFAEVRDPNFEAIFCEYTLALHNSYREHAKEEVPDFLS-RGE 349

  Fly   347 LFLEEVQQTAHVQLPHAIFMMKVI----LADNSTIPKDYKDVDFSVLTKNTGAKTI 398
            |..|.|:...:.....|.|:|.::    ::..........|.:....|.|.|.:.:
  Fly   350 LLKEYVRFLPYSLSISASFLMSLVDPLDISPEEMFALQLSDEEIIERTMNRGGEVV 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 69/354 (19%)
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 65/324 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.