DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and F59B1.10

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_872223.1 Gene:F59B1.10 / 353438 WormBaseID:WBGene00019101 Length:428 Species:Caenorhabditis elegans


Alignment Length:255 Identity:62/255 - (24%)
Similarity:107/255 - (41%) Gaps:56/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 TKVDRDAVLVQENVTTRG-----YRPGN--RHRPYN---LAETVLILHYLAQYHALPIALRLKKP 185
            ||:|       |..:.:|     |..|:  || .|:   :.|...||..:|:..    ||.|:.|
 Worm   148 TKLD-------EKNSNKGFIGMEYVEGSIVRH-SYDTCTIEEIQPILRAIAKLQ----ALSLQNP 200

  Fly   186 -QVYEEYVRPYFKKFDMNSNIDQAETEIMNKEILKDIKLVTSDERDVNRVK-------------E 236
             ::.::     .:|.| |..|.|...::|..|  ..||.:....|::.|.:             |
 Worm   201 AEISKD-----LQKID-NGAIFQETLKMMLSE--SGIKGIFEQCRNLERSRFGEKVDRIEEKRNE 257

  Fly   237 LLDIFQAFQASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDI 301
            :||..:||.. |.|.......|.|||||..|.:    .....|.....:|||:|::..|:...|:
 Worm   258 ILDFEKAFNL-NKVVGIKQNVLCHGDLWAANFL----WTENNGVFCATRIVDYQMSHLGNPAEDL 317

  Fly   302 IFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYELFLEEVQQTAHVQLP 361
            :.:|.|::.....:.::...|..:|:.|:..|.|   ..:.||    ||:::.:..:..|
 Worm   318 VRLLVSTITGADRQAHWQQILEQFYSYFLNELGS---GEAPYT----LEQLKLSFKLYFP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 57/229 (25%)
F59B1.10NP_872223.1 DUF1679 8..422 CDD:369592 62/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.