DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG33510

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:233 Identity:55/233 - (23%)
Similarity:93/233 - (39%) Gaps:27/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 RDAVLVQENVTTRGY---RPGNRHRPYNLAETVL--ILHYLAQYHALPIALRLKKPQVYEEYVRP 194
            |..:.|.:||...||   .||.|.    |.|..:  ||..||..||..||...::.:......|.
  Fly   130 RKDLFVMQNVEDMGYVALPPGTRF----LNENQMGPILKSLATLHASSIAYEKQQGKTIGVEFRK 190

  Fly   195 YFKKFDMNSNIDQAETEIMNKEILKDIKLVTSDERDVNRVKELLDIFQAFQASND-----VDDGP 254
            :.|:..::..::...|.:  :.:|. :..:..|..|....:|.  |.|......|     |:..|
  Fly   191 WLKEVSVDPEVEWYTTGL--RAVLA-VAAIHPDVLDNPEAQEY--IAQELPRCLDKVYCMVNPSP 250

  Fly   255 F--TTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDN 317
            .  ...||.|.|..|:........||.:.|    ||||:.:|.....|...|.:.:::....:..
  Fly   251 VHRNVFVHRDAWNANVFYHKEKPHEERSIL----VDFQLCRYSPPAMDFHLVTYLNLEPFSRKKM 311

  Fly   318 FYNFLTIYYNAFIQTLRSVNVDTSNYTYELFLEEVQQT 355
            ..:.:..||:|..:..|.:.|:.  |..:|..:|.:|:
  Fly   312 IGSLIETYYDALAEEFREMGVNP--YQEQLSKQEFEQS 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 50/213 (23%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 48/207 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459641
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.