DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG33511

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:380 Identity:86/380 - (22%)
Similarity:146/380 - (38%) Gaps:93/380 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EGCTLDSYSTSYLTKPGDNYGSIMLSVQAKIRSAD-----GGIRDLPLIAKLPPLTNDLYWQIF- 78
            |.|.|.:..|..:.|. ||.  |:::.|....|.|     |....|.|.|::.......:...| 
  Fly     7 EECHLIAQRTLSVVKK-DNV--ILINSQVDAGSKDLMGYMGEYYKLHLEAEVKGDKKKYFLNYFI 68

  Fly    79 -------QPER-TC------ITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNR 129
                   :|:| .|      ..|:|:|..:.|::.|...:.         .:|:.|.|       
  Fly    69 KSLPRKNEPQREECERKGVFQKESALYSQILPKIQKYATKK---------LYPKCYYS------- 117

  Fly   130 ATKVDRDAVLVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKK-PQVYEEYVR 193
                 |:.:||.|:: |:.||....:..|.|....::|.:|::.||..||...|: .::||.|  
  Fly   118 -----RNDILVLEDL-TQDYRHLRANEYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESY-- 174

  Fly   194 PYFKKFDMNSNIDQAETEIMNKEILKDIKLVTSDERDVNRVKELLDI------FQAFQASNDVDD 252
                                 |.:|.::.|.:::...:..:|.::.:      ||..:|.|.:.|
  Fly   175 ---------------------KNVLIELHLDSNNSWYITGLKAIVFLAARNPHFQTMKAQNFIQD 218

  Fly   253 -------------GPFTT----LVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHD 300
                         .|..|    |.|.|.|.:|::. |..:.....|....|||||:.||.|...|
  Fly   219 KLYNLLTKAEELVAPSKTIRNVLCHRDTWDHNIVY-YFNKESSVLPNACCIVDFQLTQYCSPTLD 282

  Fly   301 IIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYELFLEEVQQT 355
            ::|:|:......|....:...|..||......|..:.:|.:..|...|.:|.|:|
  Fly   283 VLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITENNFRKECQRT 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 75/345 (22%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 69/323 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.