DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG5126

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster


Alignment Length:318 Identity:65/318 - (20%)
Similarity:121/318 - (38%) Gaps:84/318 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 NAVYQY--LSPELDKL----QLESGI----LPAQIFDGFPRYYGSRVSLDNRATKVDRDAVLVQE 142
            |.::.|  :.|..:.:    .|||.:    :|...|..|....|    |.|     .|::||..:
  Fly    88 NEIFAYAEILPAYENVLRTSHLESEVVKNWVPCCYFARFGHVEG----LGN-----GRESVLALK 143

  Fly   143 NVTTRGYRPGNRHRPYNLAETVL--ILHYLAQYHALPIALRLKKPQV------------------ 187
            ::...||:.|.|   ..|....|  ::..:..:|||..|.::.:|.|                  
  Fly   144 HLKGDGYQLGPR---LTLRRDQLEAMVGLVGPFHALGYATKILQPNVHARLRAGVVDMPFVSSSG 205

  Fly   188 ---YEEYVRPYFKKFDMNSNIDQAETEIMNKEILKDIKLVTSDE---RDVNRVKE--------LL 238
               ::...|..|.:|          .|..:::  |:..|..:|.   ..:.|::|        ||
  Fly   206 KGIFDVLYRVAFDRF----------YEFYDRQ--KEQLLQGADPGFGAAIERLREKYFKQPTLLL 258

  Fly   239 DIFQAFQASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIF 303
            :..:....:.|..|..|.|.:|||...||::..||...:...   :|.:|||..::.:...|:.|
  Fly   259 ERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAEDKVDA---IKAIDFQELRFSTTAIDLSF 320

  Fly   304 VLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSV-----------NVD--TSNYTYELF 348
            .::.:......::.:.:.|..|:.:.|:.|..|           .||  ...|::|.|
  Fly   321 FMYMNTPSEGRKEIYADLLRKYHRSMIEMLELVLRRNRNELTDDRVDQLLQEYSFERF 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 60/303 (20%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 59/291 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.