DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG7135

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster


Alignment Length:426 Identity:106/426 - (24%)
Similarity:176/426 - (41%) Gaps:87/426 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EVPKIKNLPQVIEPHLPEGC-TLD----SYSTSYLTKPGDNYGSIMLSVQAKIRSADGGIRDLPL 62
            |.|.:...||.....|..|. .||    ....:.||:.|:||.|.:...|.|.|:|:....:..|
  Fly     6 EEPPLYLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYCSNIYRAQIKYRNAESCAMETSL 70

  Fly    63 IAKLPPLTNDLYWQIFQPERTCI--------TENAVYQYLSPELDKLQLESGILPAQIFDGF--- 116
            |.|..|           .|:..|        .|...|.::.|:|:.|...:       .|.|   
  Fly    71 IVKSMP-----------DEKQAILARLHIYNKETLFYMHIKPKLEALMWRA-------VDSFSAW 117

  Fly   117 ---PRYYGSRVSLDNRATKVDRDAVLVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPI 178
               |::|.|       .|:.::..:|  |::...||:...|....:.....|::..||:||||.:
  Fly   118 TLAPKHYYS-------TTQPEQTIIL--EDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTM 173

  Fly   179 ALRLKKPQ-VYEEYVRPYFKKFDMNSNIDQAETEIMNKEILK--------------DIKLVTSDE 228
            .:..::|: :.:.|.   |....|::...:....:...::||              ..||....|
  Fly   174 VMAEREPETIVDRYP---FGLLHMDAINSEPFKLLFGTQLLKLAALVGDCEGFGGITTKLYRYHE 235

  Fly   229 RDVNRVKELLDIFQAFQASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQ 293
            ....||   |......:.:::|       |.|||||:||:..||   ..|.|..:|||:|||:..
  Fly   236 HFTERV---LKAVYPLRGNHNV-------LNHGDLWVNNIFFKY---DAEYTVQQVKIIDFQLCF 287

  Fly   294 YGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYELFLEEVQQ---- 354
            ||||..||.:.|.:|:::.||.|.....:.|||.:.:..|:.:.......:||..::|:::    
  Fly   288 YGSLGFDINYFLNTSLELEVLRDRRQELVDIYYRSLVDCLKHLPWSKELPSYEDIMDEIRKREAY 352

  Fly   355 ---TAHVQLPHAIFMMKVILADNSTIPKDYKDVDFS 387
               .|....| .:.|:.|...|||.  |::.|..|:
  Fly   353 GFFVAFGFFP-LMSMIGVDSEDNSL--KNFHDETFA 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 83/330 (25%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 83/329 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459206
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.