DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG31300

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster


Alignment Length:405 Identity:91/405 - (22%)
Similarity:159/405 - (39%) Gaps:76/405 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPLTNDLYWQIFQPERTCITENAVYQYLSPELDK 100
            ||:|.|:|....|:..:|.|.. ..|||.|..|..:.....:........||..:|..:.||.::
  Fly    53 GDHYASVMFRTTAECTTAKGKF-SRPLIIKAMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFER 116

  Fly   101 LQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRDAVLVQENVTTRGYRPGNRHRPYNLAETVL 165
            :..|||. ..::|  .|..|.   ||:.|       .|::.|::..:||.. .|.||....|...
  Fly   117 ILRESGD-DTKLF--VPCIYH---SLEPR-------KVMIFEDLVPQGYYV-IRDRPVAQEELKT 167

  Fly   166 ILHYLAQYHALPIALRLKKPQVYEEYVRPYFK----KFD------MNSNIDQAE--TEIMN-KEI 217
            ....||::||:.:....::|...:|:....|:    |.|      |.|.|:..:  .|:.. |..
  Fly   168 AFAKLAKWHAISMKYIKEQPDFLKEFKYGLFEMPTVKTDPFITTGMQSFIEMLDRLPELRKYKPH 232

  Fly   218 LKDIKLVTSDERDVNRVKELLDIFQAFQASNDVDDGPFTTLVHGDLWINNMMLK--YGMRGEEGT 280
            .:.||     ::.:.|::.::..:...:.|:     .|..|.|||..:.|||.|  .|....|.|
  Fly   233 FEKIK-----DKYMQRLQAVMKEYHENRKSD-----AFYVLCHGDFHLRNMMFKNNKGTGAHEDT 287

  Fly   281 PLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSV--------- 336
            .|    |||||:....:..|:.:.::..::.....:...:.:..|....:.||:|:         
  Fly   288 ML----VDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSIGYPGELPTQ 348

  Fly   337 -----NVDTSNYTYELFLEEVQQTAHVQLPHAIFMMKVILADNSTIPKDY------KDVDFSVLT 390
                 .:..:.| |:.||........:.:....|.:..::.|..|..|.|      |||      
  Fly   349 AKLWDEIHKNKY-YDFFLLSTFLPLILAIKSKSFKVNDLIQDPETRQKTYFLDTYVKDV------ 406

  Fly   391 KNTGAKTIVTKFEAI 405
                 ..::.|||.:
  Fly   407 -----SKLLPKFEQL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 76/329 (23%)
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 76/316 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459651
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.