DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG31102

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001262951.1 Gene:CG31102 / 326118 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster


Alignment Length:358 Identity:83/358 - (23%)
Similarity:144/358 - (40%) Gaps:63/358 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TKPGDNYGSIMLSVQAKIRSADGGIRDLPLIAKL--------PPLTNDLYWQIFQPERTCITENA 89
            |.||:.|.|:::.:...|...||..:....|.|.        ....|.|  .||..|:      .
  Fly    48 TPPGETYTSLLMRIVIDIELKDGFSQQKSYIVKTMLDDAQGNGGFVNTL--NIFPKEK------M 104

  Fly    90 VYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLD-----NRATKVDRDAVLVQENVTTRGY 149
            :|:.:.|.|::|..|:|:                 |:.     :.|..:.....||||::.|:.|
  Fly   105 MYETIIPNLEQLYEEAGL-----------------SVKFAPKCHHAEDIKGRICLVQEDLQTKKY 152

  Fly   150 RPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVYEEYVRPYFKKFDMNSNIDQAETEIMN 214
            |..||.:.:::|....:|..||::||.....|.:|....:::.|.|.......|...||..:...
  Fly   153 RNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYLPANYQKSKSYQARLQSYK 217

  Fly   215 KEI----LKDIKLVTSDERDVNRVKELLDIFQAFQASNDVDDGPFTTLVHGDLWINNMMLKYGMR 275
            ..|    |.|      .|:.|:|:.......|::.:..:.:...|..|.|||.|.:|:||.|...
  Fly   218 TAIASWGLAD------HEQYVSRIPTADQFVQSYASCFNNNPQEFKVLNHGDFWSSNIMLSYTQT 276

  Fly   276 GEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIY------------YNA 328
            |:..   :|:.||||:.::||...|:..::..|...::....|..|:.||            |:.
  Fly   277 GDIN---QVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTHLVRCLKILKYSE 338

  Fly   329 FIQTLRSVNVDTSNYTYELFLEEVQQTAHVQLP 361
            .|..||.:::....|.:..:.........:.||
  Fly   339 RIPMLRELHMSMIKYGFWGYFTTFTHLVFILLP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 79/330 (24%)
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 75/319 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459622
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.