DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG1561

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster


Alignment Length:394 Identity:90/394 - (22%)
Similarity:153/394 - (38%) Gaps:81/394 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPLTNDLYWQIFQPERTC-ITENAVYQYLSPELD 99
            ||||    |.|..::::|....|.  |:.||||.......|.|  .|.| :.|.|.|:...|...
  Fly   258 GDNY----LGVVWRLQAASDSKRS--LVVKLPPQNRVRRKQFF--ARPCFLRETAAYEVFLPLTA 314

  Fly   100 KLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRDAVLVQENVTTRGYRPGNRHRPYNLAETV 164
            .:|.:..|:....|......:|:|....|..        :|.|:::..|:...||....::....
  Fly   315 LIQDKWKIIGDDRFRQHALCFGTRQDEPNEC--------IVLEDLSCAGFSLHNRFLDLSVEHVR 371

  Fly   165 LILHYLAQYHALPIALRLKKPQ----------VYEE-----YVRPYFKKFDMNSNIDQAETEIMN 214
            .::...|:.||:.:|.:.:.|:          ::|:     .:..||:..               
  Fly   372 RVMLTYAKLHAISLAGKRQLPEKMQQLQQLVDIFEQRRDDHALGVYFENL--------------- 421

  Fly   215 KEILKDIKLVTSDERDVNRVK------------ELLDIFQAFQASNDVDDGPFTTLVHGDLWINN 267
            ||......|..:|  |..||:            .||.:...|...      ||..:.|||.|.||
  Fly   422 KESALSALLAPAD--DAYRVRLEAYFARGSYFELLLPLVSGFNCE------PFAVICHGDCWNNN 478

  Fly   268 MMLKYGMRGEEGTPLK-VKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAF-I 330
            ::.|...|||    |: |:::|:|:.:|.|.|.|:.:.||:.......:.:..|.|..||... :
  Fly   479 ILYKSTERGE----LEDVRLIDWQLMRYASPVTDLAYFLFTCTSRRFRQRHLENMLEDYYEELGL 539

  Fly   331 QTLRSVNVDTSNYTYELFLEEVQQTAHVQLPHAIFMMKVILADNSTIPKDYKDVDFSVLTK--NT 393
            |.:|........:....|.|:|...|.|.|..|:.::.::......:|      |...:::  ..
  Fly   540 QLIRLGERVEQLFPRPAFDEQVATKAAVGLLLAMMVLPIVTMQGQDVP------DLQAISERIEA 598

  Fly   394 GAKT 397
            ||.|
  Fly   599 GATT 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 78/330 (24%)
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 78/330 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459661
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.