DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG31975

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster


Alignment Length:428 Identity:197/428 - (46%)
Similarity:289/428 - (67%) Gaps:24/428 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MG--EVPKIKNLPQVIEPHLPEGCTLDSYSTSYLTKPGDNYGSIMLSVQAKIRSADGGIRDLPLI 63
            ||  ::|:|:.|.:|:|||: .|..|.:|.||.||||||||||::|::.|:::.::|...:..|:
  Fly     1 MGVDKLPEIRALSEVVEPHV-SGSRLLNYHTSSLTKPGDNYGSVLLAIHARLQKSNGESFEEQLV 64

  Fly    64 AKLPPLTNDLYWQIFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDN 128
            ||:||: :..|||.||||:||:||||||:.|:|.|..||.|:|:.....|.||||:||.|.||::
  Fly    65 AKVPPI-DPKYWQFFQPEQTCLTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGCRESLES 128

  Fly   129 RATKVDRDAVLVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVYEEYVR 193
            .::|||::||||.||:.:.||..|.|.:.::||.|:|.|.|:|::|||.:|||:.:|:|:.|.||
  Fly   129 NSSKVDQNAVLVLENLRSSGYVSGQRLKAFDLAHTLLALKYMAEFHALSLALRILRPEVFREQVR 193

  Fly   194 PYFKKFDMNSNIDQAETEIMNKEILKDIKLVT-SDERDVNRVKELLD-IFQAFQASNDVDDGPFT 256
            |:|||||.::...:.:: :|..|.|:||:..| :|.|.|.|:|||.| .|:...|:.|..|||||
  Fly   194 PFFKKFDWHAEAPEWKS-VMKAETLEDIRRATNNDSRLVARMKELSDQFFEFLAAAPDRPDGPFT 257

  Fly   257 TLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNF 321
            :::|.|.||||:|.:|   |..|||:::||:|||.|||.|:|||||..|.||||..:||..|.:.
  Fly   258 SIIHCDFWINNIMFRY---GPTGTPVELKIIDFQTAQYDSVVHDIISFLLSSVDTAILEVEFEHM 319

  Fly   322 LTIYYNAFIQTLRSVNVDTSNYTYELFLEEVQQTAHVQLPHAIFMMKVILADNSTI--------P 378
            |..||.||.:.||.|......:|::.|..||::.|::|:||||||.:.||||::.|        |
  Fly   320 LEAYYEAFERCLRRVGAKLEVHTFKEFRLEVKRVAYIQVPHAIFMTRFILADSALIGDSEAEERP 384

  Fly   379 KDYKDVDFSVLTKNTGAKTIVTKFEAILRLGKKFNIFY 416
            |      .:.:.||||::.|..|...||.|.:||:|.|
  Fly   385 K------LTDVLKNTGSERISRKLSQILNLAEKFDILY 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 147/303 (49%)
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 147/303 (49%)
APH <214..329 CDD:279908 60/117 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451049
Domainoid 1 1.000 160 1.000 Domainoid score I8345
eggNOG 1 0.900 - - E1_2AMXB
Homologene 1 1.000 - - H51954
Inparanoid 1 1.050 203 1.000 Inparanoid score I6157
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016761
OrthoInspector 1 1.000 - - otm50576
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13591
109.890

Return to query results.
Submit another query.