DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG31436

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster


Alignment Length:398 Identity:82/398 - (20%)
Similarity:154/398 - (38%) Gaps:103/398 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPL---TNDLYW--QIFQPERTCITENAVYQYLS 95
            ||:|.|||...:.|..:..|..:...:|..:|..   ..|:..  .||:      ||..:|..:.
  Fly    53 GDHYASIMFRARVKYTNRKGEFQKSLIIKTMPEAEGHKKDMLGGSPIFE------TEMGLYTKVL 111

  Fly    96 PELDKLQLESGILPAQIFDGFPRY----YGSRVSLDNRATKVDRDAVLVQENVTTRGYRPGNRHR 156
            ||.:::.       .|:.|....|    |.|          ::...||:.|::...||.. .|.|
  Fly   112 PEFERIL-------RQVGDDTQLYVNCIYHS----------LEPHQVLIFEDLAEMGYIV-LRDR 158

  Fly   157 PYNLAETVLILHYLAQYHALPIALRLKKPQVYEEYVRPYFKKFDMNSNIDQAETEIMNKEILKD- 220
            ...|.|...|...||::||:.:.::.::|:..|.|....|:.           ..::|...::. 
  Fly   159 DATLDEIRRIYFKLAKWHAVSLKVQNEQPEFLESYTHGLFEM-----------PHVLNDPFMRTG 212

  Fly   221 ----IKLVTSDERDVNRVK------------ELLDIFQAFQASNDVDDGPFTTLVHGDLWINNMM 269
                ::|: ..|.::|:.|            .|::.::..:.|...|:  :..|.||||.:.|:|
  Fly   213 MEFFVELL-GKEPELNKYKPYFESIKDDFLERLVEEWKDIRKSQKKDE--YWVLCHGDLHLRNIM 274

  Fly   270 LKYGMRGEEGTPLK-VKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTL 333
            .|:    ::...|: ..::||||:....|..|:::.::..::.....:|:.:.:..|.:.....|
  Fly   275 FKH----KDTVSLEDCMLLDFQISNLFPLTFDLLYSIYMLLEPEHRWNNWDDLINYYISVLQDVL 335

  Fly   334 RSV--------------NVDTSNYTYELFLEEVQQTAHVQLPHAIFMMKVILADNSTIPKDYKDV 384
            :.:              .:....| ||.||      ....||     :...|.|        |.|
  Fly   336 KKIGYKGVMPSQSGLWKRLHQHKY-YEFFL------ISTFLP-----LMWALRD--------KSV 380

  Fly   385 DFSVLTKN 392
            ||..|.:|
  Fly   381 DFGDLLQN 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 67/341 (20%)
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 67/328 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459655
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.