DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG31288

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster


Alignment Length:420 Identity:88/420 - (20%)
Similarity:166/420 - (39%) Gaps:88/420 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KNLPQVIEPHLPEGCTLDSYSTSYLTKPGDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPLTND 72
            |....|:....|:...:..::......||:|:.|.||.|..|:...||.::           |..
  Fly    23 KYFESVLAKDEPDHVKVLKFTVVAAIPPGENFTSTMLRVYIKLEMKDGSVK-----------TKT 76

  Fly    73 LYWQIFQPER---TCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVD 134
            ..::...||.   :.|.|..::    |:  :..:....|||  |:...:..|..:.|..:....:
  Fly    77 YIFKTMLPEERGGSDINEFGLF----PK--EAMMYKTYLPA--FEALYKDVGWDIQLAPKCLHTE 133

  Fly   135 R---DAVLVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVYEEYVRPY- 195
            .   |...:.|::..:.::..:|.:..::......|..||:|||        ...||||...|| 
  Fly   134 EREGDIHFIFEDLCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHA--------ASAVYEELHGPYP 190

  Fly   196 ------FKKFDMNS-NID--QAETEIMNKEI----LKDIKLVTSDERDVNRVKELLDIFQAFQAS 247
                  |.|.|:.. ::|  |.:.:...|.:    |||.      ::.:.....:...:....::
  Fly   191 SEFSEGFVKKDVKKFHVDGFQLKEKAYKKAMLSWGLKDA------DKYIKAFPTVKQYWAQCLST 249

  Fly   248 NDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVN 312
            .:::...|..|.|||.|.:|:|..|   ..:||..|:.::||||..:||...|::|.|..|...:
  Fly   250 LELNPDEFHVLNHGDFWSSNLMSSY---LPDGTLEKLILIDFQIVMWGSPAMDLLFFLTLSPTND 311

  Fly   313 VLEDNFYNFLTIYYNAFIQTLRSV--------------NVDTSNYTYELFLEEVQQTAHVQLPHA 363
            :....|.:|:.||:...::.|:.:              :::..|:::..|...:.     .||..
  Fly   312 LRIKEFDHFVRIYWERLVECLKVLKLKKPLPKLRDLQNSMNNKNHSFYAFFSILN-----HLPII 371

  Fly   364 IFMMKVILADNSTIPKDYKDVDFSVLTKNT 393
            :|            |.| ||.:...|:.||
  Fly   372 LF------------PTD-KDSNIHNLSANT 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 73/335 (22%)
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 72/316 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459620
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.