DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG32195

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:376 Identity:82/376 - (21%)
Similarity:147/376 - (39%) Gaps:85/376 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GCTL---DSYSTSYLTKPGDNYGSIMLSVQAKI-RSADGGIRD--------LPLIAKLPPLTNDL 73
            ||.:   :::....:::.|:|:.|::..|.... ||.||.:..        ||..|.|.....|:
  Fly    20 GCEMLRVENFHIKAVSQKGENFCSVIYRVALVFRRSPDGALESGKYILKDLLPAAAALGTNEKDM 84

  Fly    74 YWQIFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRDAV 138
            : ::..|....|.|.|     ..|:.:.:|.:..|..:|..|...|                   
  Fly    85 F-EVLLPAMQAILEEA-----PKEIGEHKLSADCLLVEISAGKELY------------------- 124

  Fly   139 LVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVYEEYVRPYFKKFDMNS 203
             :.|::...||...:|.:..||.|..:.:..|||:|.....|..|||::.:. :.|......:|.
  Fly   125 -ILEDLGALGYESFDRRQGLNLEEAKICVRKLAQFHGASKVLYEKKPELIQR-LSPSHYANGLND 187

  Fly   204 NIDQA---------------ETEIMNKEILKDI-KLVTSDERDVNRVKELLDIFQAFQASNDVDD 252
            ...||               |...::|::...| |..|...|||                .|.:.
  Fly   188 RFAQALVLEGAEYAAEAFAEELPEISKKMKAQIPKAYTKRMRDV----------------VDPNK 236

  Fly   253 GPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDN 317
            .....::|||.|:||:|..:..:       |..:||||...:||...|:.|:.::|:...:|.:|
  Fly   237 SSLNAVIHGDPWLNNIMFDFVNK-------KATLVDFQNCYWGSPAIDLYFLFYTSLKPELLLNN 294

  Fly   318 FYNFLTIYYNAFIQTLRSVNVDTSNYTYELFLEEVQQ-------TAHVQLP 361
            ....|..|::..::|||......:..|:....:|:::       |...:||
  Fly   295 QDELLNYYFDNLLETLRHCGYKDTLPTFGQLKDEMKRCLFYGYYTVVCELP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 75/326 (23%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 75/327 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459342
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.