DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and CG33301

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster


Alignment Length:392 Identity:85/392 - (21%)
Similarity:146/392 - (37%) Gaps:87/392 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IEPHLPEGCTLDSYSTSYL-TKP----GDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPLTNDL 73
            ::|.|...|..|......: .||    |:|:..:|..:....:..||.:.:...|.|........
  Fly    11 LQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYIVKQALSAEVP 75

  Fly    74 YWQIFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRD-A 137
            ..::|........|..:|:::.|:|.:|..|:|:             ..:::.|  |..|||: .
  Fly    76 QAEVFFEYELYTREMDMYEFILPKLKELLQEAGL-------------DQKLTAD--AITVDREYN 125

  Fly   138 VLVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKP----------------Q 186
            .::.|::....:...:|.:..::|.|.|.|..||::||..|.|:.:.|                :
  Fly   126 TMILEDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERHPNLLTKCFYTHFFSRDKK 190

  Fly   187 VYEEYVRPYFKKF----DMNSNIDQAETEIMNKEILKDIKLVTSDERDVNRVKELLDIFQAFQAS 247
            .|.......||.|    |...|:.:|..:.::       ||.|             .|.:....:
  Fly   191 AYSVVFAGLFKAFLRFIDGQPNLKEAYGDKLH-------KLRT-------------HIMEYGARA 235

  Fly   248 NDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVN 312
            .||.:....||.|||.|..|:|.:|...||   |..|..:|||.:...|...|:.:...:|:...
  Fly   236 YDVGESDLKTLNHGDCWTTNIMFQYDDAGE---PRSVVAIDFQFSNCTSPTIDLHYFFTTSLREE 297

  Fly   313 V------LEDNFY-----NFLTIYYNAFIQTLRSVNVDTSNYTYELFLEE---VQQTAHVQLPHA 363
            |      |.::.|     |.....|...:.||:.         |.|..|.   :...||:..|..
  Fly   298 VGDKESELVEHHYKALKANLEKFSYKGSLPTLQE---------YRLQFERRRFMSLLAHMFKPCM 353

  Fly   364 IF 365
            |:
  Fly   354 IY 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 73/337 (22%)
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 69/322 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459330
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.