DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and nhr-246

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001256661.1 Gene:nhr-246 / 191499 WormBaseID:WBGene00014192 Length:386 Species:Caenorhabditis elegans


Alignment Length:364 Identity:67/364 - (18%)
Similarity:133/364 - (36%) Gaps:114/364 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NLPQVIEPHLPE---GCTLDSYSTSYLTKPGDNYGSIMLSVQAKIRSADGGIR--DLPLIAKLPP 68
            :||:.:...:|:   ||::                         :.:|.||::  |..::.:...
 Worm    58 DLPKHVVLKIPQNTKGCSV-------------------------VENAGGGVKNVDHSVVERFMH 97

  Fly    69 LTNDLYWQIFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKV 133
            .|...|:::|    :.::|.                    |.||    |..|     |.::|.:.
 Worm    98 NTECNYYKLF----SSLSEK--------------------PLQI----PTTY-----LASKAGEK 129

  Fly   134 DRDAVLV---QENVTTRGYRPG-NRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVYEEYVRP 194
            ....|:|   .|:.......|| |..:.:.:.:.::.||.        .:|..:|   ::|.| |
 Worm   130 APVPVIVLEMLEDCKLHDLIPGFNEDQLFKIVDELVKLHI--------FSLTTEK---WKEIV-P 182

  Fly   195 YFKKFDMNSNI-----DQAETEIMNKEILKDIKLVTSD-ERDVNRVKELLDIFQAFQASNDVDDG 253
            ...|..|:..:     |.......|.|:...:..|.:. :.|.|.::::.|.:        :::.
 Worm   183 DESKLAMSGFLQCMVADVGRKLAQNPELGVILSYVENTLDTDPNYLQKMRDEY--------INEE 239

  Fly   254 PFTTLVHGDLWINNMM--LKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDV----- 311
            ..:.:.|||||...::  .:..:.|         |||:|....||.:.|:..:|.:...|     
 Worm   240 RPSVICHGDLWAPQILWDKEDNIAG---------IVDWQATHRGSPMEDLHHILSTCTSVQNRKT 295

  Fly   312 --NVLEDNFYNFLTI--YYNAFIQTLRSVNVDTS-NYTY 345
              ..|.|::||.|.:  ....|..|.....:|.. ||::
 Worm   296 FTKPLLDHYYNKLKVGLKEKGFKTTWTREEIDIEYNYSF 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 59/324 (18%)
nhr-246NP_001256661.1 CHK 134..314 CDD:214734 42/208 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.