DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and T16G1.3

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_506237.2 Gene:T16G1.3 / 188553 WormBaseID:WBGene00011797 Length:389 Species:Caenorhabditis elegans


Alignment Length:433 Identity:96/433 - (22%)
Similarity:162/433 - (37%) Gaps:127/433 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VIEP-------HLPEGCTLDSYSTSYLTKPGDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPLT 70
            ::||       |||....|...|..::....|     .:::|.|..||                 
 Worm    28 LVEPDWTVHGEHLPNRFVLKITSCMHVLNVLD-----QMNLQDKSESA----------------- 70

  Fly    71 NDLYWQIFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDR 135
               .|.||:.|...:....|..|  ..:.|..::..::..::|  |.:.:.|             
 Worm    71 ---LWSIFEYEAQGLHNREVNLY--EIIGKWNMDDVLMSPKVF--FSKKFDS------------- 115

  Fly   136 DAVLVQENVTTRGY-------RPGNRHRPYNLAETVL--ILHYLAQYHALPIALRLKKPQV---- 187
                  ||: |:|:       ....||...||....|  ||..||.:.|..:.|..::.:.    
 Worm   116 ------ENL-TKGFFAMEYVDNAITRHLYINLKSYELHSILKSLAVFQAESLKLNKREQESVTGY 173

  Fly   188 -YEEYVRPYFKKFDMNSNIDQAETEIMNKEILKD---------IKLVTSDERDVNRVKELLDIFQ 242
             .|:.|...|.:..:||..:|...  :|||.|.:         ::||..|.  |..:...|.|.:
 Worm   174 DLEKIVGKMFSQNGLNSIFEQVRQ--INKEELSEAADKIAVFGVELVNFDL--VKNLNNYLGIKK 234

  Fly   243 AFQASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKV-KIVDFQIAQYGSLVHDIIFVLF 306
                         ..|||||||..|:|.|     |.....:| ||:|:|....|:...|::.:..
 Worm   235 -------------NVLVHGDLWSANIMWK-----ENKDEFRVDKIIDYQSIHLGNPAEDLVRLFI 281

  Fly   307 SSVDVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYELFLEEVQQTAHVQLPHAIFMM---- 367
            |::..:..:..:...|..:|..||:.|...||.   ||    ||:::::..:.......:|    
 Worm   282 STLSGSERQKYWEKLLEQFYEYFIEALEDKNVP---YT----LEQLKESYRLYFVTGSLLMLPMF 339

  Fly   368 ----KVILADNSTIP---KDYKDVDFSVLTKNTGAKTIVTKFE 403
                :|.||:.|. |   |.|::    :||:.|  |.::...|
 Worm   340 GPIAEVKLAEMSD-PDEVKKYRE----ILTEKT--KRLLNDME 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 70/325 (22%)
T16G1.3NP_506237.2 PKc_like 1..381 CDD:389743 96/433 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.