DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and H06H21.8

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001023255.1 Gene:H06H21.8 / 186700 WormBaseID:WBGene00019164 Length:388 Species:Caenorhabditis elegans


Alignment Length:379 Identity:80/379 - (21%)
Similarity:152/379 - (40%) Gaps:87/379 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KIKNLPQVIEPHLPEGCTLDSY------STSYLTKPGDNYGSIMLSVQAKIRSADGGIRDLP--L 62
            |:|.|.:::|...||   ::::      |...|......:..|.:   |.::....|:: :|  :
 Worm     4 KLKQLRRLVESSFPE---IENFHEKVDASFEKLENAKSFWSEIYV---AHLKVVGDGVK-VPESV 61

  Fly    63 IAKLPPLTNDLYWQIFQPERTCITENAV--------YQYLSPELDKLQLESGILPAQIFDGFPRY 119
            ..|:|.::.::.        .|..|:||        |......|.....|.|.:|.  |. ||:.
 Worm    62 FIKVPRISENVL--------RCEDESAVNHLNDVLLYYSKKENLFYKHFEYGSIPN--FP-FPKV 115

  Fly   120 YGSRVSLDNRATKVDRDAVLVQENVTTRGYR----PGNRHRPYNLAETVL-ILHYLAQYHALPIA 179
            |.:. .::..||     ..:|.||::.:.:.    ||.:|      |.:| ::..||..|:.   
 Worm   116 YFTE-DINGEAT-----GGIVAENLSEKVFAVEHIPGLKH------EQILRLMEALAGLHSF--- 165

  Fly   180 LRLKKPQVY-EEYV-----RPYFKKFDMNSNIDQAET------EIMNKEILKDIKLVTSDERDVN 232
            |..:..:.| |.:|     |..|.:...|...::|.|      |:...:.:::||  .|.:..:.
 Worm   166 LMKRDDKSYVESFVEGAHGRETFSEGMQNMMFEEALTLENVSPEVFGNDRIRNIK--WSFDYSIK 228

  Fly   233 RVKELLDIFQAFQASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSL 297
            . |...|...||..          .:.|.||.:.|::.|.....:|.:    .|:|:|:...||:
 Worm   229 N-KATADAISAFPG----------IICHADLNVTNVLWKKDSAKDEIS----AIIDYQMLFIGSI 278

  Fly   298 VHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYELFLEE 351
            ..|||.||...::..:......|:|..|:    :||..::...:.::.|..|.:
 Worm   279 AFDIIRVLTLGLNREIRRKMTQNYLDHYH----KTLTELSNGKAPFSMEELLHQ 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 70/328 (21%)
H06H21.8NP_001023255.1 CHK 129..312 CDD:214734 49/212 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.