DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and F56A4.5

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_503669.1 Gene:F56A4.5 / 186348 WormBaseID:WBGene00018913 Length:418 Species:Caenorhabditis elegans


Alignment Length:378 Identity:70/378 - (18%)
Similarity:115/378 - (30%) Gaps:105/378 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KIKNLPQVIEPHLPEGCTLDSYSTSYLTKPGDNYGSIMLSVQAK-IRSADGGIRDLPLIAKLPPL 69
            |.:|||......:........:|.......|:.:|...|....| ||  :|..|::.....|..|
 Worm    65 KNQNLPSKFAVKISTQLAFAVFSKITKFDGGNGFGEEKLKFLGKFIR--EGHNREVEAYKLLEKL 127

  Fly    70 TNDLYWQIFQPERTCITENAVYQYLSPELDKLQLES--------GILPAQIFDGFPRYYGSRVSL 126
            .:        |:   |.....| ||.|..||..|:.        .:.|..:::..|.        
 Worm   128 NH--------PD---IPHTKAY-YLKPFKDKFDLKGFMILDFVPNVHPMPMYESIPA-------- 172

  Fly   127 DNRATKVDRDAVLVQENVTT---RGYRPGNRHRPYNLAETVLILHYLAQY---------HALPIA 179
                    .|.:.:...|.|   .|.......|.:.....:..|.:...|         ..:...
 Worm   173 --------DDLISLVRGVATFAGHGESLTAEQRSFARGSDIFELMFEEMYPDEQLERVCGVIQAT 229

  Fly   180 LRLKKPQVYEEYVRPYFKKFDMNSNIDQAETEIMNKEILKDIKLVTSDERDVNRVKELLDIFQAF 244
            ...|.|.|.||.::.::                          :..:..:..::|.|||      
 Worm   230 FGAKNPAVVEECIKLFW--------------------------IYKNSIKSYSKVSELL------ 262

  Fly   245 QASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSV 309
                    |....|.|||||.:||:   ....|.|..:...|:|:|.........|:..:|...:
 Worm   263 --------GFKLVLNHGDLWQSNML---HCLDEHGNLVLKAIIDWQGVSMLPPGLDLARLLMGCL 316

  Fly   310 DVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYELF-LEEVQQTAHVQLP 361
            ......:.....|.:|:..|          |.....||| |||:|.:.::..|
 Worm   317 TAYERRERGAELLMLYHQTF----------TGIVGEELFSLEELQDSYNLYYP 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 56/322 (17%)
F56A4.5NP_503669.1 DUF1679 3..409 CDD:369592 70/378 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I8086
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.