DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31974 and F48G7.12

DIOPT Version :9

Sequence 1:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_503277.2 Gene:F48G7.12 / 186000 WormBaseID:WBGene00018623 Length:435 Species:Caenorhabditis elegans


Alignment Length:367 Identity:89/367 - (24%)
Similarity:136/367 - (37%) Gaps:102/367 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VIEPHLPEGCTLDSYSTSYLTKPGDNYGSIMLSVQAKIRSADGGIRDLPLIAKLP---PLTNDLY 74
            |.:.||||...|.  .||.|..||       |..|.|              .|.|   |......
 Worm    69 VSDKHLPEKFVLK--ITSCLHVPG-------LIEQMK--------------GKNPGTFPAQEAAL 110

  Fly    75 WQIFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRDAVL 139
            |.||:.|...:....|..|...|  |......:|..:|      |:..:...:|: ||    .:|
 Worm   111 WAIFENEAQKLHNREVNLYKITE--KWNKNETMLSPKI------YFYKKFDAENK-TK----GIL 162

  Fly   140 VQE---NVTTRGYRPGNRHRPYNL--AETVLILHYLAQYHALPIALRLKKPQVYEEYVRPYFKKF 199
            ..|   |||.       ||...|:  .|...:|..:|...|  .:|.|.|.::            
 Worm   163 GMEFDGNVTV-------RHIYCNVKPRELYPVLRSIATLQA--GSLHLTKDEI------------ 206

  Fly   200 DMNSNID--QAETEIMNKEILKDIKLVTSDERDVN--RVKELLDIFQAF--------QASN---- 248
            :..|.:|  |....:||.|.:|.....|   |::|  |:.|..::.:||        .|.|    
 Worm   207 ESISGLDVKQMMGSLMNNEGMKGFYEQT---REINRKRLTEKTNVVEAFGQEVVNFELACNLNKY 268

  Fly   249 -----DVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSS 308
                 ||       :||||||..|::.|   ..:|||....|::|:|:...|:...|::.:..|:
 Worm   269 IGIKRDV-------MVHGDLWAANILWK---EKDEGTFSVSKVIDYQLIHMGNPAEDLVRLFLST 323

  Fly   309 VDVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYELFLE 350
            :.....:.::...|..:|..|:..|..   |.:.|:.|...|
 Worm   324 LSGADRQAHWERLLEKFYTYFLAALGD---DEAPYSLEQLKE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 76/330 (23%)
F48G7.12NP_503277.2 DUF1679 10..421 CDD:369592 89/367 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.